close all open/close all

CDS information : Aran_00180


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction25,870 / 22,835 / - [in whole cluster]
25,870 / 22,835 / - [in contig]
Locationcomplement(22835..25870) [in whole cluster]
complement(22835..25870) [in contig]
TypeCDS
Length3,036 bp (1,011 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
ProductSNF2 family protein
Product (GenBank)helicase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf18
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Family/Domain
FD
IPR022138, IPR000330, IPR001650

close this sectionSequence

selected fasta
>SNF2 family protein [helicase]
MPGRGRMAFWGTPDPATDAKGAGLSDGTSEVASLPTVVPGGGRLVRAEMPALLVPLGEVL
RALAGLPPAAVDADDGGGGAPGSQGNVRLDRSVYAWSVAARWALEHVVAGHAVPLLRAGP
DGRHLAHWHVDPVGDPRLDALAEALPAAAHALRVDTGVTLDAAITVDAEPAGARLWSAQA
LLEAFCDAVADLCVRASASAPDPAAEPAEPARRLRGRTEGSGASRPPGTADASPATWSRA
WLGALAGERAEVVHERLPAVDDVERWAAAASGERVPARLCLRLGLPAGPDSPWPLDFHLQ
AADEPGLLLPAQRVWRSHASAIPLGSRLLDNPQETLTASLGVAARWFRPLAACLGEARPV
QVRLTPFDAAALFGDAGNDLRNAGIGVVVPRELEDGARVLGPRLRVGSRRGGRRTDVTDT
AGARHRTVTYRWEAVVGDEVLTSEEVTELAARGEPFALWRDVWVRVDTERVAELASLVGR
TGRLSAAEALSVALCGRHRTEEFGDVPALAEGSVADLVSRLRSALADEEPRLAGVRAELR
DYQRRGIAWLQSLTELGFGALLADDMGLGKTLQTIALLAGRPRQRPQLVVCPTSVVSNWH
REAARFAPDLTVRLHHGPRRATRPEEFAPGTVHVTSYALLRLDADLLTSVDWDLVVLDEA
QQIKNHTAQTARAAFRLTSHARVALTGTPVENRLSELWSIMHFANPGLLGSHRRFKEQVA
VPVERDGDQESADRLRTVTAPFMLRRMKSAVVDELPAKLESTVSCDLTAEQTRLYRAALD
EAFDTDDGLGSGIQRQGNVLRLLTRLKQICNHPAQFLGEEDTDAGRLAGRSGKLERATEM
LGEVVASGERALVFTQYRVMGDLLARHLSGELGLARVPFLHGGTPTEHRDRMVRAFQEDD
DAPPLLLISLKAGGFGLNLTRASHVMHYDRWWNPAVEDQATDRAHRIGQTKTVLVHKLVT
ADTFEERIDALLQSKRSLADAVVGAGETWLTELDDDALHALVRLADSGDTA
selected fasta
>SNF2 family protein [helicase]
ATGCCCGGACGGGGGCGTATGGCTTTCTGGGGGACGCCCGACCCGGCGACGGACGCGAAG
GGTGCGGGCCTGAGCGACGGCACGTCCGAGGTCGCCTCGCTGCCCACGGTGGTGCCCGGC
GGCGGCCGTCTGGTCCGGGCGGAGATGCCCGCGCTGCTGGTGCCGCTGGGCGAGGTGCTG
CGCGCGCTGGCCGGTCTGCCACCGGCGGCCGTCGACGCCGACGACGGTGGCGGTGGTGCC
CCGGGTTCGCAGGGGAACGTCCGGCTCGACCGGTCGGTGTACGCCTGGTCCGTCGCCGCC
CGCTGGGCGCTGGAGCACGTCGTCGCCGGGCACGCCGTACCCCTGCTGCGTGCCGGGCCG
GACGGCCGGCACCTGGCGCACTGGCACGTCGACCCCGTCGGCGACCCCCGCCTGGACGCG
CTCGCCGAGGCCCTGCCGGCCGCCGCGCACGCCCTGCGTGTGGACACCGGGGTCACCCTG
GACGCTGCGATCACCGTGGACGCGGAACCCGCCGGAGCCCGGCTCTGGTCGGCGCAGGCC
CTGCTGGAGGCGTTCTGCGACGCGGTGGCCGACCTGTGCGTCCGTGCGTCCGCCTCGGCC
CCGGACCCGGCCGCGGAGCCGGCCGAACCCGCCCGACGGCTCCGTGGACGCACGGAAGGA
TCCGGCGCGTCCCGGCCTCCCGGAACGGCCGACGCCTCCCCCGCGACCTGGTCGCGGGCC
TGGCTCGGCGCGCTGGCCGGGGAACGGGCCGAGGTGGTGCACGAGCGGCTGCCCGCCGTG
GACGACGTGGAGCGCTGGGCGGCGGCGGCATCGGGTGAGCGCGTTCCGGCCCGGCTGTGC
CTGCGGCTGGGGCTGCCCGCCGGGCCCGACTCGCCCTGGCCGCTGGACTTCCATCTCCAG
GCGGCGGACGAGCCCGGTCTGCTGCTGCCCGCGCAGCGGGTGTGGCGCAGCCACGCCTCC
GCGATCCCGCTCGGCAGCCGCCTCCTGGACAACCCGCAGGAGACGCTGACCGCCTCGCTC
GGCGTGGCCGCGCGCTGGTTCCGGCCCCTCGCGGCCTGCCTGGGCGAGGCCCGGCCCGTC
CAGGTACGCCTCACTCCGTTCGATGCCGCGGCCCTCTTCGGCGACGCGGGCAACGACCTG
CGCAACGCGGGCATCGGGGTGGTGGTCCCGCGGGAGCTGGAGGACGGTGCCCGGGTGCTC
GGGCCGCGGCTGCGGGTCGGATCCCGGCGCGGCGGCCGGCGGACCGATGTGACGGACACC
GCCGGGGCCCGGCACCGGACCGTCACCTACCGCTGGGAGGCGGTGGTGGGCGACGAGGTC
CTCACCTCGGAGGAGGTGACCGAACTGGCAGCGCGCGGTGAGCCGTTCGCCCTGTGGCGC
GATGTCTGGGTACGCGTCGACACCGAGCGTGTGGCCGAACTCGCCTCCCTGGTGGGGCGG
ACCGGGCGGCTGTCCGCCGCGGAGGCCCTGTCGGTAGCGCTGTGCGGACGCCACCGTACG
GAGGAGTTCGGCGACGTCCCCGCCCTGGCCGAGGGGTCGGTCGCCGACCTGGTGAGCCGG
CTGCGTTCGGCCCTCGCCGACGAGGAGCCCCGACTCGCGGGTGTGCGCGCCGAGTTGCGC
GACTACCAGCGCCGGGGCATCGCCTGGCTCCAGTCGCTGACCGAGCTGGGCTTCGGCGCC
CTGCTCGCCGACGACATGGGTCTGGGCAAGACGCTCCAGACCATCGCCCTGCTGGCCGGC
CGGCCCCGGCAGCGGCCGCAGCTCGTGGTCTGCCCGACCTCCGTGGTGAGCAACTGGCAC
CGTGAGGCCGCGCGGTTCGCGCCGGACCTGACCGTTCGGCTGCACCATGGGCCGCGCCGG
GCCACCCGTCCCGAGGAGTTCGCCCCCGGGACCGTCCATGTGACCAGCTACGCGCTGCTG
CGCCTGGACGCCGATCTGCTGACCTCCGTCGACTGGGACCTGGTCGTCCTCGACGAGGCC
CAGCAGATCAAGAACCACACCGCGCAGACCGCGCGTGCCGCGTTCCGGCTGACCTCGCAC
GCCAGGGTGGCGCTGACCGGCACCCCCGTGGAGAACCGGCTGTCGGAGCTGTGGTCGATC
ATGCACTTCGCCAACCCTGGCCTGCTCGGCTCGCACCGCCGCTTCAAGGAGCAGGTCGCC
GTCCCCGTCGAACGGGACGGCGACCAGGAGTCCGCGGACCGGCTGCGTACCGTCACGGCG
CCCTTCATGCTGCGCCGGATGAAGAGCGCCGTCGTCGACGAGCTGCCCGCCAAGCTGGAG
TCCACGGTCTCCTGCGACCTGACCGCGGAGCAGACCAGGCTGTACCGGGCCGCCCTGGAC
GAGGCGTTCGACACGGACGACGGACTGGGCAGCGGCATCCAGCGGCAGGGCAACGTGCTG
CGGCTGCTCACCCGGCTCAAGCAGATCTGCAACCACCCGGCCCAGTTCCTGGGCGAGGAG
GACACCGACGCCGGGCGGCTCGCCGGGCGCTCGGGCAAGCTGGAGCGGGCCACCGAGATG
CTCGGCGAGGTCGTGGCGTCCGGTGAACGGGCGCTGGTGTTCACCCAGTACCGGGTGATG
GGCGATCTGCTGGCCCGTCATCTGTCGGGCGAGCTCGGCCTGGCGCGGGTGCCGTTCCTG
CACGGCGGGACACCGACGGAACACCGGGACCGGATGGTACGCGCGTTCCAGGAGGACGAC
GACGCTCCGCCGCTGCTGCTGATCAGCCTCAAGGCGGGCGGCTTCGGCCTGAACCTGACC
CGCGCCTCGCACGTGATGCACTACGACCGGTGGTGGAACCCGGCCGTCGAGGACCAGGCC
ACGGACCGCGCGCACCGGATCGGTCAGACCAAGACCGTCCTGGTGCACAAGCTGGTCACC
GCCGACACCTTCGAGGAGCGCATCGACGCCCTGCTGCAGAGCAAGCGTTCGCTGGCCGAC
GCCGTCGTCGGCGCCGGAGAGACCTGGCTGACCGAGCTGGACGACGACGCGCTGCACGCG
CTGGTCCGGCTCGCCGACTCGGGAGACACCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000330 SNF2-related (Domain)
 [542-814]  5.20000000000001e-68 PF00176
PF00176   SNF2_N
IPR001650 Helicase, C-terminal (Domain)
 [862-948]  4.60000044330862e-22 SM00490
SM00490   HELICc
 [833-990]  PS51194
PS51194   HELICASE_CTER
 [877-948]  2.2e-11 PF00271
PF00271   Helicase_C
IPR014001 Helicase, superfamily 1/2, ATP-binding domain (Domain)
 [551-707]  PS51192
PS51192   HELICASE_ATP_BIND_1
 [535-718]  7.99999145876753e-29 SM00487
SM00487   DEXDc
IPR022138 Helicase SWF/SNF-related (Family)
 [355-494]  3.7e-28 PF12419
PF12419   DUF3670
SignalP No significant hit
TMHMM No significant hit