close all open/close all

CDS information : Aran_00190


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction27,349 / 26,090 / - [in whole cluster]
27,349 / 26,090 / - [in contig]
Locationcomplement(26090..27349) [in whole cluster]
complement(26090..27349) [in contig]
TypeCDS
Length1,260 bp (419 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)O-methyltransferase
Gene
Gene (GenBank)
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • orf19
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
Q9AJU2
NITE
Ello_00170
PmId
[11376004] Deoxysugar methylation during biosynthesis of the antitumor polyketide elloramycin by Streptomyces olivaceus. Characterization of three methyltransferase genes. (J Biol Chem. , 2001)

close this sectionSequence

selected fasta
>putative O-methyltransferase [O-methyltransferase]
MPTDATTTLENPGGTSPGAASETPPQTALETALIRLADRSDAEVAAGLADLGPDRCARAL
LRETADRARLFPEPPVATAVEVRLRLGEERSAYTVTLGGGAHEVTLGPAEAARARLTQDL
PEFLRAVYGAPGRHDATRELHITEPDRPVLDPADPEHAERAAAVTALHQLAGALARPHRS
LNELAVHFRSDKWGGHWYTPHYDRYFAPLRDGVVNLVEIGIGGYDDPDQGGASLRMWKHY
FPRGLVHGLDVYEKRGIAEPRLFPLRGDQSDPAYLAGLAAERGPFDIVVDDGSHLNEHVL
TSFEALFPHLRPGGLYVVEDTQTAYWTGWGGNDRDLNDPTTSMGFVKALVDGLNHQERTP
AQDGPVSPAARWERGIGAVHVHHNLVVVEKSVNTEQGAPAWVPRDVDPRSWYTAPERSE
selected fasta
>putative O-methyltransferase [O-methyltransferase]
GTGCCGACGGACGCCACGACCACGCTCGAGAACCCCGGGGGCACCTCACCCGGGGCGGCC
TCTGAGACGCCCCCGCAGACGGCCCTGGAGACCGCCCTCATCCGCCTCGCAGACCGCTCC
GACGCCGAGGTCGCCGCGGGCCTCGCCGACCTGGGCCCGGACCGCTGCGCCCGGGCGCTG
CTGCGCGAGACCGCCGACCGGGCGCGTCTCTTCCCCGAGCCGCCGGTCGCGACGGCGGTG
GAGGTACGGCTGCGGCTGGGCGAGGAGCGGTCGGCGTACACGGTCACCCTGGGCGGCGGC
GCCCACGAGGTGACGCTGGGCCCGGCCGAGGCGGCACGGGCGCGCCTCACCCAGGACCTG
CCGGAGTTCCTGCGAGCCGTGTACGGGGCGCCGGGCCGGCACGACGCCACCCGCGAGCTG
CACATCACCGAGCCGGACCGGCCGGTGCTCGACCCGGCCGACCCCGAGCACGCCGAACGG
GCCGCCGCCGTGACGGCCCTGCACCAGCTGGCCGGCGCGCTCGCCCGGCCGCACCGCTCA
CTGAACGAACTGGCCGTGCACTTCCGCTCCGACAAGTGGGGCGGACACTGGTACACCCCG
CACTACGACCGCTACTTCGCCCCGCTGCGGGACGGCGTCGTCAACCTCGTGGAGATCGGC
ATCGGCGGCTACGACGATCCCGATCAGGGCGGTGCCTCCCTGCGCATGTGGAAGCACTAC
TTCCCGCGCGGCCTGGTCCACGGCCTGGACGTCTACGAGAAGCGCGGCATCGCCGAGCCC
CGGCTGTTCCCGCTGCGCGGCGACCAGTCGGACCCCGCGTACCTGGCCGGGCTGGCCGCC
GAGCGGGGGCCGTTCGACATCGTCGTCGACGACGGCAGCCACCTCAACGAGCATGTGCTG
ACCTCCTTCGAGGCCCTCTTCCCGCATCTGCGGCCCGGCGGTCTGTACGTCGTCGAGGAC
ACCCAGACCGCGTACTGGACGGGCTGGGGCGGCAACGACCGCGACCTGAACGACCCCACC
ACCTCCATGGGGTTCGTGAAGGCCCTCGTCGACGGCCTCAACCACCAGGAGCGCACCCCG
GCGCAGGACGGGCCCGTCTCCCCCGCCGCCCGCTGGGAACGCGGCATCGGCGCGGTACAC
GTCCACCACAATCTGGTGGTCGTGGAGAAAAGCGTGAACACCGAGCAGGGAGCTCCCGCC
TGGGTTCCGCGCGATGTCGATCCGCGCAGTTGGTACACCGCCCCCGAACGAAGCGAATAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit