close all open/close all

CDS information : Aran_00200


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction27,737 / 29,260 / + [in whole cluster]
27,737 / 29,260 / + [in contig]
Location27737..29260 [in whole cluster]
27737..29260 [in contig]
TypeCDS
Length1,524 bp (507 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)transmembrane efflux protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf20
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
Q9WVV3
PmId
[10198016] Mitomycin resistance in Streptomyces lavendulae includes a novel drug-binding-protein-dependent export system. (J Bacteriol. , 1999)
ACC
P42670
PmId
[7916693] The pur8 gene from the pur cluster of Streptomyces alboniger encodes a highly hydrophobic polypeptide which confers resistance to puromycin. (Eur J Biochem. , 1993)

close this sectionSequence

selected fasta
>putative drug resistance transporter [transmembrane efflux protein]
MSSNSASAQTGAPSSVPTARLAGRTGIALTIIVVCQLMIVLDMMIVQIALPDMKSSLGLS
TASMSWVINAYTLAFGGLLLLGGRAGDILGRRRVFLIGVAVFTLASFAGGLATEDWQLLA
ARAVQGAGGAMAAPNTLALIMSIFEEGPKRARAIAMYSVVGGSGAAIGLILGGVLTDVAS
WRWVMFVNVPIGVAVFLLTPLFISETEKHSGRFDLAGALTSTAGMVALVYGVTHASESGW
TDTSTLVAFALAVVLLPSFVAIERTARQPVVSLKLFLDRTRASSYIAMLLIQGSMIGMLF
FLSQFVQQIFDYSPLTAGLCFLPVAAVLVPVAGMVTKLVAQVGSKVLVIAGAVLLTGANW
WLSRLDEGSSYWADLLPPMLIFGVGMALATIPPTMLALSGVAPEESGSASSVLNALQQVG
GSLGLAVLVTVFTEGGHRAADDATPGQDPSTLSDRILVGSVEWGFLAATCFAAATIVVAL
FFLSRRQEQERAAGAPEQAPGAASVHV
selected fasta
>putative drug resistance transporter [transmembrane efflux protein]
GTGTCATCCAATTCGGCGTCCGCGCAGACCGGGGCACCTTCGTCCGTGCCCACGGCTCGA
CTGGCGGGACGCACCGGAATCGCCCTGACGATCATCGTGGTCTGCCAGCTCATGATCGTG
CTGGACATGATGATCGTCCAGATCGCCCTGCCCGACATGAAGTCCAGCCTCGGGCTGTCC
ACCGCCAGCATGTCCTGGGTGATCAACGCCTACACCCTCGCCTTCGGCGGGCTGCTGCTG
CTCGGCGGCCGGGCCGGTGACATCCTCGGCCGGCGCCGGGTGTTCCTGATCGGCGTCGCG
GTGTTCACCCTCGCCTCGTTCGCCGGCGGGCTGGCCACCGAGGACTGGCAGCTGCTCGCG
GCCCGCGCGGTGCAGGGGGCGGGCGGCGCGATGGCCGCGCCCAACACCCTCGCCCTGATC
ATGTCGATCTTCGAAGAGGGCCCCAAGCGGGCCCGCGCCATCGCGATGTACTCGGTGGTC
GGCGGATCCGGCGCGGCGATCGGCCTGATCCTCGGCGGTGTGCTGACCGACGTCGCCTCC
TGGCGCTGGGTCATGTTCGTCAACGTGCCCATCGGCGTGGCCGTCTTCCTGCTCACACCG
CTGTTCATCAGCGAGACCGAGAAACACTCCGGACGCTTCGACCTGGCCGGCGCCCTCACC
TCCACGGCGGGCATGGTCGCCCTCGTCTACGGCGTCACGCACGCCTCCGAGAGCGGCTGG
ACGGACACCTCCACGTTGGTGGCCTTCGCGCTGGCCGTCGTCCTGCTGCCGTCGTTCGTG
GCGATCGAGCGCACCGCGCGCCAGCCGGTCGTCAGCCTCAAGCTGTTCCTCGACCGCACC
CGGGCGAGTTCCTACATCGCCATGCTGCTCATCCAGGGCAGCATGATCGGGATGCTGTTC
TTCCTCTCCCAGTTCGTACAGCAGATCTTCGACTACAGCCCGCTGACCGCCGGCCTGTGC
TTCCTGCCGGTGGCCGCGGTCCTCGTCCCCGTGGCGGGCATGGTCACCAAGCTCGTCGCC
CAGGTCGGCAGCAAGGTGCTGGTGATCGCCGGTGCCGTGCTGCTCACCGGCGCCAACTGG
TGGCTGTCCCGGCTCGACGAGGGCAGCAGCTACTGGGCCGACCTGCTGCCTCCGATGCTG
ATCTTCGGCGTCGGTATGGCGCTCGCCACCATTCCGCCCACCATGCTGGCACTGTCCGGG
GTGGCGCCCGAGGAGTCGGGCTCGGCCTCCAGCGTGCTCAACGCCCTCCAGCAGGTAGGT
GGTTCGCTCGGGCTCGCCGTTCTGGTCACCGTCTTCACCGAGGGCGGCCACCGGGCGGCG
GACGACGCCACACCCGGGCAGGACCCGTCCACCCTCTCCGACCGCATCCTGGTCGGCAGC
GTCGAGTGGGGCTTCCTCGCGGCGACCTGCTTCGCGGCGGCGACCATCGTGGTCGCCCTG
TTCTTCCTGTCCCGCCGACAGGAACAGGAGCGCGCTGCGGGCGCGCCCGAGCAGGCGCCC
GGCGCGGCGAGCGTCCACGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [30-433]  6.90000000000007e-75 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [33-424]  1.09999999999999e-51 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-490]  2.7000136937899e-68 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [28-487]  PS50850
PS50850   MFS
SignalP
 [1-1]  Signal-anchor
Eukaryota   
 [1-8]  0.397 Signal
Bacteria, Gram-negative   
TMHMM
 [27-49]  Transmembrane (i-o) [59-81]  Transmembrane (o-i) [94-113]  Transmembrane (i-o) [123-145]  Transmembrane (o-i) [154-176]  Transmembrane (i-o) [181-203]  Transmembrane (o-i) [215-233]  Transmembrane (i-o) [243-262]  Transmembrane (o-i) [283-305]  Transmembrane (i-o) [315-335]  Transmembrane (o-i) [342-364]  Transmembrane (i-o) [379-401]  Transmembrane (o-i) [410-432]  Transmembrane (i-o) [461-483]  Transmembrane (o-i)
Transmembrane 14