close all open/close all

CDS information : Aran_00210


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction29,585 / 30,868 / + [in whole cluster]
29,585 / 30,868 / + [in contig]
Location29585..30868 [in whole cluster]
29585..30868 [in contig]
TypeCDS
Length1,284 bp (427 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)L-rhamnosyltransferase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • glycosyltransferase; orf21
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
[16713002] Cloning, purification and characterization of a functional anthracycline glycosyltransferase. (J Biotechnol. , 2006)

close this sectionSequence

selected fasta
>glycosyltransferase [L-rhamnosyltransferase]
MRVLITVPPLDAHFNGSVPLAWALRTAGHEVRVAAQPPLTAGITSAGLTAVPVGDDPGLA
AVMARKGPRIYAHHEGRDLRRAATAPDGPEFLRTSSALLTDAFYSRIGSEETVDDLVAFC
RAWRPDLVVWETFTFAGAIAAHVTGVPHARLLWGPDLFAFMRDALLDHHRRAGVDAGSTP
GADPLRDWITGQLARFGEEFTEAVVRGLWRIDQMPEELRLAPGQHTVPLRYVPYNGPVPA
VVPPWLRHDPDRPRVCLTKGFSVRTIDSPDGRAVTTDDFFDAVADLDAEVVALLDETDRA
ALTTVPANTRVVDFTPLHVLLPTCAAIVHHGGAGTWSTAAVHGVPQLLLASMWDNVFRAV
RTEELGAGLFLPPAELTPAALRGALERLLKEPSFADGADHLRRAMTSQPAPHTVVTELER
LAAQPAA
selected fasta
>glycosyltransferase [L-rhamnosyltransferase]
ATGCGTGTTCTGATCACCGTGCCGCCACTCGATGCCCATTTCAACGGCTCCGTCCCCCTG
GCCTGGGCCCTGCGCACGGCAGGTCACGAGGTTCGCGTGGCCGCACAGCCACCCCTGACC
GCCGGCATCACCTCCGCCGGCCTCACCGCAGTACCGGTCGGCGACGACCCGGGCCTGGCC
GCCGTCATGGCCCGCAAGGGCCCGCGGATCTACGCCCACCACGAGGGCCGGGACCTGCGC
CGGGCCGCCACCGCCCCCGACGGCCCGGAGTTCCTGCGGACCAGCAGCGCCCTGCTCACC
GACGCCTTCTACTCCCGTATCGGCAGCGAGGAGACCGTCGACGACCTGGTCGCCTTCTGC
CGCGCATGGCGGCCCGACCTCGTCGTGTGGGAGACGTTCACCTTCGCCGGAGCGATCGCC
GCACACGTCACCGGCGTCCCGCACGCCCGGCTGCTGTGGGGCCCCGACCTGTTCGCGTTC
ATGCGCGACGCCCTCCTCGACCACCACCGGCGCGCCGGAGTGGACGCGGGCAGCACTCCC
GGCGCCGATCCCCTGCGGGACTGGATCACCGGCCAACTCGCCCGCTTCGGGGAGGAGTTC
ACGGAGGCCGTCGTCCGCGGACTGTGGCGGATCGACCAGATGCCCGAAGAACTGCGCTTG
GCTCCAGGCCAGCACACCGTCCCCCTGCGGTACGTGCCCTACAACGGACCGGTCCCCGCC
GTCGTACCGCCCTGGCTGCGGCACGACCCCGACCGGCCGCGGGTCTGCCTGACCAAGGGG
TTCAGCGTGCGCACCATCGACTCGCCCGACGGACGCGCGGTGACCACGGACGACTTCTTC
GACGCCGTCGCCGATCTCGACGCGGAGGTCGTCGCCCTCCTCGACGAGACCGACCGGGCA
GCGCTGACCACCGTGCCCGCCAACACCCGCGTCGTCGACTTCACCCCGCTGCACGTCCTG
CTGCCCACCTGCGCGGCGATCGTGCACCACGGCGGCGCCGGCACCTGGTCCACCGCGGCC
GTCCACGGAGTGCCCCAGCTGCTCCTGGCCTCCATGTGGGACAACGTCTTCCGGGCCGTA
CGGACGGAGGAACTCGGCGCCGGCCTGTTCCTGCCGCCCGCCGAGCTGACCCCCGCGGCC
CTGCGCGGCGCGCTGGAGCGTCTGCTGAAGGAGCCGTCCTTCGCGGACGGCGCCGACCAC
CTCCGCCGGGCGATGACGTCCCAGCCCGCCCCCCACACGGTCGTCACGGAGCTGGAACGG
CTCGCCGCACAGCCGGCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [12-154]  2.1e-12 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [211-310]  1.6e-28 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.245 Signal
Bacteria, Gram-positive   
 [1-35]  0.173 Signal
Eukaryota   
TMHMM No significant hit