close all open/close all

CDS information : Aran_00220


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction32,867 / 31,341 / - [in whole cluster]
32,867 / 31,341 / - [in contig]
Locationcomplement(31341..32867) [in whole cluster]
complement(31341..32867) [in contig]
TypeCDS
Length1,527 bp (508 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative FAD-dependent oxidoreductase
Product (GenBank)oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf22
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
Q0PCD7
NITE
Acla_00150
PmId
[17242508] Structure determination by multiwavelength anomalous diffraction of aclacinomycin oxidoreductase: indications of multidomain pseudomerohedral twinning. (Acta Crystallogr D Biol Crystallogr. , 2007)
[17395717] Aclacinomycin oxidoreductase (AknOx) from the biosynthetic pathway of the antibiotic aclacinomycin is an unusual flavoenzyme with a dual active site. (Proc Natl Acad Sci U S A. , 2007)
ACC
Q9ALN1
NITE
Spino_00120
PmId
[17985910] The biosynthesis of spinosyn in Saccharopolyspora spinosa: synthesis of the cross-bridging precursor and identification of the function of SpnJ. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative FAD-dependent oxidoreductase [oxidoreductase]
MTDGARHRPPLGPVRVTPADPRYRDLIRGVNHRFTGSPGQIRIVGSAEQTVEAVQDAVDA
GLRLAVRSGGHCLEDLVDGPDTAFLLDMSEMRQVYYDPGMRAFAVEPGAHLGDVYRTLYK
GWGVTVPGGSCPTVAAGGHFAGGGYGPLTRLHGCVVDHLYAVEVVVVDAAGRARLVVASR
DDEGELGDLWWAHTGGGGGTFGVVTRYWLRTAGATGSDPAGLLPHPPSAVLDSLVTWSWE
GMTAERFRRLMRNHAEWHERNGAADSPYASLFSVLGVMHPASGVLVMSTQMDATVPDAER
LLAGYVDALDEGVGLRPAHTVRARPWLESMLQPTLPDTVTGMRSKGKAAYLRKGYTDGQL
DALYRGLTDERYTNPGAGVLFMSYGGAVSAVAPDATATAQRDAVLKALYVTLWREPEEDA
AHLAWIRGLYREVYAHSGGVPVPDEVSDGAYVNYPDTDLADPRWNTSGVPWSTLYYKDNY
PRLRRVKASWDPKGVFRHALSVEPPASE
selected fasta
>putative FAD-dependent oxidoreductase [oxidoreductase]
ATGACCGACGGCGCGCGTCATCGGCCGCCGCTGGGGCCGGTCCGGGTCACGCCGGCCGAT
CCGCGGTATCGGGACCTGATCAGGGGCGTCAACCACCGGTTCACCGGCAGCCCGGGTCAG
ATACGGATCGTCGGGTCGGCCGAGCAGACCGTCGAGGCGGTGCAGGACGCCGTCGACGCG
GGGCTGCGGCTCGCGGTCCGCAGCGGCGGGCACTGCCTGGAGGACCTGGTGGACGGGCCC
GACACCGCCTTCCTCCTCGACATGTCCGAGATGCGGCAGGTGTACTACGACCCCGGCATG
CGGGCCTTCGCGGTGGAGCCCGGGGCCCATCTGGGCGACGTCTACCGCACGCTGTACAAG
GGGTGGGGCGTCACGGTTCCCGGTGGCTCGTGCCCGACGGTCGCGGCGGGCGGTCACTTC
GCCGGCGGCGGGTACGGTCCGCTGACCCGGCTGCACGGCTGCGTCGTGGACCATCTGTAC
GCGGTCGAGGTCGTCGTGGTCGACGCGGCGGGCCGGGCCCGGCTGGTGGTGGCGTCCCGG
GACGACGAAGGCGAACTCGGCGACCTGTGGTGGGCACACACCGGCGGGGGCGGCGGTACG
TTCGGCGTGGTGACGCGGTACTGGCTGCGGACCGCCGGCGCGACCGGAAGCGACCCCGCG
GGCCTGCTGCCGCACCCCCCGTCGGCGGTGCTGGACAGCCTGGTGACCTGGTCGTGGGAG
GGCATGACCGCCGAGCGGTTCCGCCGGCTGATGCGCAACCACGCCGAGTGGCACGAGCGC
AACGGCGCCGCCGACTCCCCCTACGCGTCCCTGTTCAGCGTGCTCGGCGTGATGCACCCG
GCCTCGGGGGTGCTGGTGATGAGCACCCAGATGGACGCCACGGTCCCGGACGCCGAGCGC
CTGCTGGCGGGATACGTGGACGCTCTCGACGAGGGGGTGGGACTGCGTCCGGCGCACACC
GTGCGCGCCAGGCCCTGGCTGGAGTCGATGCTGCAGCCCACCCTGCCCGACACCGTCACC
GGCATGCGTTCCAAGGGCAAGGCCGCCTACCTCCGCAAGGGGTACACGGACGGACAGCTC
GACGCGCTGTACCGGGGTCTGACGGACGAGCGGTACACCAATCCCGGCGCCGGCGTGCTG
TTCATGTCGTACGGCGGCGCGGTCAGCGCCGTGGCTCCCGACGCCACCGCCACGGCCCAG
CGCGACGCCGTGCTCAAGGCGCTGTACGTGACGCTGTGGCGGGAGCCGGAGGAGGACGCC
GCGCATCTGGCGTGGATCCGGGGGCTGTACCGGGAGGTCTACGCGCACAGCGGTGGGGTG
CCCGTACCGGACGAGGTGAGCGACGGCGCGTACGTCAACTACCCCGACACCGACCTCGCC
GACCCGCGGTGGAACACCTCCGGCGTGCCCTGGTCCACCCTCTACTACAAGGACAACTAC
CCGCGGCTGCGGCGGGTGAAGGCGAGCTGGGATCCCAAGGGGGTCTTCCGGCACGCCTTG
TCGGTGGAGCCGCCGGCGAGCGAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006094 FAD linked oxidase, N-terminal (Domain)
 [41-166]  3.09999999999998e-18 PF01565
PF01565   FAD_binding_4
IPR012951 Berberine/berberine-like (Domain)
 [450-502]  2.4e-18 PF08031
PF08031   BBE
IPR016166 FAD-binding, type 2 (Domain)
 [9-214]  1.20000117458134e-32 SSF56176
SSF56176   FAD-binding_2
 [34-214]  PS51387
PS51387   FAD_PCMH
IPR016168 FAD-linked oxidase, FAD-binding, subdomain 2 (Domain)
 [96-169]  2.5e-05 G3DSA:3.30.465.20
G3DSA:3.30.465.20   FAD-linked_oxidase_FAD-bd_sub2
SignalP No significant hit
TMHMM No significant hit