close all open/close all

CDS information : Aran_00230


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction33,305 / 34,192 / + [in whole cluster]
33,305 / 34,192 / + [in contig]
Location33305..34192 [in whole cluster]
33305..34192 [in contig]
TypeCDS
Length888 bp (295 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-7 ketoreductase
Product (GenBank)oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf23
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
Q9RN66
NITE
Nogl_00130
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
ACC
Q53882
NITE
Dauno_00060
PmId
[8655529] Cloning, sequencing, and analysis of aklaviketone reductase from Streptomyces sp. strain C5. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative C-7 ketoreductase [oxidoreductase]
MTDYSHDPDSPNPSAPTAAPSAHSPTAPSAHSPTAPSAQAPTTPAASPPDRAVVVTGGGT
GIGRAVAHRFAEEGARVLVVGRTPGTLEETARHHPGIRALPADITAPDGPDTVVSAALER
FGRIDVLVNNAALGIAGTLDTLDPADLDAQLATNLRAPMLLTRRALPALEKSSGTVVNLS
TAGSLGRRAWPGMSVYGATKTALDFLTRTWAVELAPRGIRVVGLAPGVIDTGMATRNGAS
EEQYAAFLDGIRSRVPAGRVGRPEEIAWWVARLADPLAGYAHGTVLAVDGALSLQ
selected fasta
>putative C-7 ketoreductase [oxidoreductase]
GTGACCGACTACAGCCACGACCCCGACTCACCCAACCCCTCCGCACCCACCGCTGCCCCC
TCCGCCCACTCACCCACCGCCCCCTCCGCCCACTCACCCACCGCCCCCTCGGCGCAGGCA
CCCACCACCCCCGCCGCGTCCCCGCCCGACCGGGCCGTCGTCGTGACCGGTGGCGGGACC
GGCATCGGTCGAGCCGTCGCCCACCGCTTCGCCGAGGAAGGTGCCCGGGTCCTCGTCGTG
GGCCGGACCCCGGGCACGCTGGAGGAGACCGCGCGCCATCACCCCGGCATCCGCGCACTC
CCCGCCGACATCACCGCGCCCGACGGCCCGGACACCGTCGTCTCGGCCGCGCTGGAGCGC
TTCGGCCGGATCGACGTCCTGGTGAACAACGCCGCCCTCGGCATCGCGGGCACCCTGGAC
ACCCTGGACCCCGCCGACCTGGACGCCCAGCTCGCGACGAACCTCCGGGCCCCGATGCTG
CTGACCCGCCGCGCGCTCCCCGCGCTGGAGAAGAGCTCCGGCACGGTCGTCAACCTCAGC
ACGGCCGGCTCGCTCGGCCGCCGGGCCTGGCCCGGCATGTCGGTCTACGGCGCCACCAAG
ACCGCGCTGGACTTCCTGACCCGGACCTGGGCGGTGGAACTCGCCCCCCGCGGGATCCGG
GTGGTGGGACTGGCACCCGGTGTCATCGACACCGGCATGGCGACCCGCAACGGCGCGAGC
GAGGAGCAGTACGCGGCCTTCCTCGACGGCATCCGCTCCCGCGTCCCGGCCGGACGCGTC
GGCCGCCCCGAGGAGATCGCCTGGTGGGTGGCCCGGCTCGCCGACCCGCTCGCCGGCTAC
GCCCACGGCACCGTCCTCGCCGTCGACGGCGCCCTGTCCCTGCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [52-214]  2.6e-28 PF00106
PF00106   adh_short
 [122-133]  6.69999687625999e-09 PR00080 [174-182]  6.69999687625999e-09 PR00080 [196-215]  6.69999687625999e-09 PR00080
PR00080   SDRFAMILY
 [17-294]  2.79999889404114e-16 PIRSF000126
PIRSF000126   11-beta-HSD1
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [52-69]  1.49999648196323e-36 PR00081 [122-133]  1.49999648196323e-36 PR00081 [168-184]  1.49999648196323e-36 PR00081 [196-215]  1.49999648196323e-36 PR00081 [217-234]  1.49999648196323e-36 PR00081 [256-276]  1.49999648196323e-36 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [50-294]  2.90000000000003e-76 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-40]  0.377 Signal
Bacteria, Gram-positive   
TMHMM No significant hit