close all open/close all
Aran_00230 Aran_00230   last last

CDS information : Aran_00240


close this sectionLocation

Organism
StrainTü303
Entry nameAranciamycin
Contig
Start / Stop / Direction34,559 / 35,758 / + [in whole cluster]
34,559 / 35,758 / + [in contig]
Location34559..35758 [in whole cluster]
34559..35758 [in contig]
TypeCDS
Length1,200 bp (399 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)methyltransferase
Gene
Gene (GenBank)
EC number2.1.1.-
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • orf24
Reference
ACC
PmId
[17357167] Cloning and heterologous expression of the aranciamycin biosynthetic gene cluster revealed a new flexible glycosyltransferase. (Chembiochem. , 2007)
Related Reference
ACC
O54261
NITE
Nogl_00410
PmId
[22120896] Identification of late-stage glycosylation steps in the biosynthetic pathway of the anthracycline nogalamycin. (Chembiochem. , 2012)
ACC
Q9AJU1
NITE
Ello_00190
PmId
[11376004] Deoxysugar methylation during biosynthesis of the antitumor polyketide elloramycin by Streptomyces olivaceus. Characterization of three methyltransferase genes. (J Biol Chem. , 2001)
ACC
Q83WF2
PmId
[19415708] Functional analysis of MycE and MycF, two O-methyltransferases involved in the biosynthesis of mycinamicin macrolide antibiotics. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>putative O-methyltransferase [methyltransferase]
MTPDSLVERLVLCGTAPDSETALLAKEAGLQRLTGALVDEVLFRCEQPVNTTPVDIALEV
THEQELRRTVLRMAAGEPIRVLDADDPTAVVRRHFRFSLTDLVRRLYGPLQKPHSRDFTD
VFLPERPADLTELPQILQATHQAGGTLLSGCTSDAPGLGALSVAYGSDKWASFHWYTQHY
EHHFARYRDRPVRILEIGIGGYAGDLGGPSLKMWKRYFHRGLVFGLDLFDKSALNQPRLT
ALTGDQGDAAGLRELAERYGPFDIVIDDGSHENEHVRISFDALFPYVRPGGLYVIEDLQT
AYWPRFGGTAGAETAPDTSVGLLKRLLDDLHHAEYDPKPDTPRTATQEQVIGVHTYHNIA
FVEKGVNGESSIPAWMDDEAWKALGAITPEEGRELGASR
selected fasta
>putative O-methyltransferase [methyltransferase]
ATGACTCCGGACAGCCTTGTCGAGCGACTCGTCCTGTGCGGAACAGCGCCCGACTCCGAG
ACCGCCCTCCTCGCGAAGGAGGCGGGGCTCCAGCGCCTGACCGGCGCCCTCGTGGACGAG
GTGCTGTTCCGCTGCGAGCAGCCCGTGAACACCACCCCCGTCGACATCGCGCTGGAGGTG
ACCCACGAGCAGGAACTGCGCCGCACGGTGCTGCGCATGGCGGCCGGCGAACCGATCCGG
GTCCTGGACGCCGACGACCCCACAGCCGTGGTCCGCCGTCACTTCCGGTTCTCCCTCACC
GACCTGGTCCGCCGCCTCTACGGCCCCCTCCAGAAGCCCCACAGCCGCGACTTCACCGAC
GTCTTCCTGCCCGAGCGGCCGGCCGACCTGACGGAGCTGCCGCAGATCCTGCAGGCCACG
CACCAGGCGGGCGGCACCCTGCTGTCCGGCTGCACGAGCGACGCCCCCGGCCTGGGAGCC
CTGTCCGTGGCGTACGGCTCCGACAAATGGGCCAGCTTCCACTGGTACACCCAGCACTAC
GAGCACCACTTCGCCCGCTACCGGGACCGGCCGGTGCGGATCCTGGAGATCGGCATCGGC
GGCTACGCGGGCGACCTGGGCGGGCCGTCGCTGAAAATGTGGAAGCGGTACTTCCACCGC
GGGCTCGTCTTCGGCCTCGACCTGTTCGACAAGTCGGCGCTGAACCAGCCCCGGCTCACC
GCCCTCACCGGCGACCAGGGCGACGCCGCCGGGCTGCGTGAACTCGCCGAGCGGTACGGC
CCGTTCGACATCGTCATCGACGACGGAAGCCACGAGAACGAGCACGTGCGGATCTCCTTC
GACGCGCTCTTCCCGTACGTACGCCCCGGCGGCCTGTACGTCATCGAGGACCTCCAGACC
GCGTACTGGCCGCGGTTCGGCGGCACCGCCGGCGCCGAGACCGCGCCCGACACCTCGGTC
GGCCTGCTCAAGCGGCTCCTGGACGACCTGCACCACGCGGAGTACGACCCCAAGCCCGAC
ACACCCCGCACGGCCACCCAGGAACAGGTGATCGGCGTGCACACGTACCACAACATCGCC
TTCGTCGAGAAGGGCGTCAACGGCGAGAGCAGCATCCCGGCCTGGATGGACGACGAGGCG
TGGAAGGCGCTCGGCGCCATCACCCCGGAGGAGGGCCGGGAGCTGGGGGCGTCGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit
Aran_00230 Aran_00230   last last