close all open/close all
first first   Asco_00020 Asco_00020

CDS information : Asco_00010


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction1,836 / 412 / - [in whole cluster]
1,836 / 412 / - [in contig]
Locationcomplement(412..1836) [in whole cluster]
complement(412..1836) [in contig]
TypeCDS
Length1,425 bp (474 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)FkbW
Gene
Gene (GenBank)fkbW
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)

close this sectionSequence

selected fasta
>hypothetical protein [FkbW]
MVLPLGVGRAPRRRTGLGALTLAAVAVLLPSPATARPAPDAPDGHCARLSQLRVPAAARQ
QADCLDELTTAGTAATGHTDPADWAGLTPKNLATPTGVPGIQIDGYFPDTSTTNTNHGWN
HDAQFVIRLPDRWNGGLVVAGTPGNREQYANDRAIADWVLARGYAYAATDKGNTGPAFYR
DGSRPGDAVAEWNTRLTQLTRAARASVAQRYHRPLERTLVTGMSNGGYLVRWQLENHPEL
YDGGVDWEGTLWRAEGPNLFTFLPAALRDYPTYAAGGPAAGQAREALLRAGFPADSEFLW
PYHHEVYWDLTQRVYREEFDPGFDGEKEAGTPYCAPGTVPGCDADYDYATRSSGVHAAVE
RIALTGRIGKPLITIQALSTCCCLPPGLRRVRAYVRQRPGGRYRYYRIEDGTHTDALVDT
FPDRLRPLLPCHRSAFTALESWLTTGHRPPANHTVVRPAGADQASLLAECRLDG
selected fasta
>hypothetical protein [FkbW]
ATGGTTCTGCCCCTCGGTGTCGGACGGGCCCCGAGAAGACGCACCGGCCTCGGCGCTCTC
ACCCTGGCCGCAGTCGCCGTCCTGCTCCCCTCACCGGCCACGGCCCGGCCTGCTCCCGAT
GCCCCGGACGGTCACTGCGCCCGTCTGTCCCAGCTGCGTGTCCCGGCGGCGGCACGTCAG
CAGGCCGACTGCCTGGACGAGCTGACCACGGCGGGAACGGCGGCCACCGGCCACACCGAC
CCGGCGGACTGGGCAGGGCTGACGCCCAAGAACCTGGCCACTCCCACCGGAGTGCCCGGG
ATCCAGATCGACGGCTACTTCCCCGACACCTCCACCACCAACACCAACCACGGGTGGAAC
CACGACGCCCAGTTCGTCATCCGGCTGCCCGACCGCTGGAACGGTGGCCTGGTCGTGGCC
GGCACCCCCGGTAACCGCGAGCAGTACGCCAACGACCGGGCCATCGCCGACTGGGTGCTC
GCCCGCGGTTACGCCTACGCCGCCACCGACAAGGGCAACACCGGCCCCGCGTTCTACCGT
GATGGCTCCCGGCCGGGCGACGCCGTCGCCGAGTGGAACACCCGCCTCACCCAGCTGACC
CGGGCCGCCCGCGCGTCGGTCGCCCAGCGCTACCACCGGCCGCTCGAGCGCACCCTGGTC
ACCGGGATGTCCAACGGCGGCTACCTCGTGCGCTGGCAGCTGGAGAACCATCCCGAGCTG
TACGACGGAGGAGTCGACTGGGAAGGCACCCTGTGGCGCGCGGAGGGTCCCAACCTCTTC
ACCTTCCTGCCGGCCGCCCTGCGCGACTACCCCACCTACGCGGCAGGCGGCCCCGCAGCC
GGCCAGGCGCGCGAGGCGCTGCTCCGCGCCGGGTTCCCGGCCGACTCCGAGTTCTTGTGG
CCGTACCACCACGAGGTCTACTGGGATCTGACGCAGCGCGTCTACCGCGAGGAGTTCGAC
CCCGGCTTCGATGGGGAGAAGGAAGCCGGCACACCGTATTGCGCCCCGGGGACGGTCCCG
GGCTGCGATGCCGACTACGACTACGCCACCCGCTCCTCCGGCGTCCACGCGGCCGTGGAA
CGCATCGCGTTGACCGGTCGTATCGGCAAGCCGCTGATCACCATCCAGGCACTCTCGACG
TGCTGCTGCCTGCCGCCCGGGCTCCGACGTGTACGCGCGTATGTCCGGCAGCGGCCTGGC
GGCCGGTACCGCTACTACCGCATCGAGGACGGCACGCACACCGACGCCCTCGTCGACACC
TTCCCCGACCGACTCCGGCCTTTGCTGCCGTGTCACCGCTCAGCCTTCACCGCCCTGGAG
AGCTGGCTCACCACCGGCCACCGCCCGCCCGCGAACCACACGGTCGTCCGGCCCGCAGGT
GCCGACCAGGCGTCCCTGCTCGCCGAGTGCCGTCTCGACGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011118 Tannase/feruloyl esterase (Family)
 [114-243]  1.3e-10 PF07519
PF07519   Tannase
SignalP
 [1-35]  1 Signal
Bacteria, Gram-positive   
 [1-35]  0.999 Signal
Eukaryota   
 [1-35]  0.999 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
first first   Asco_00020 Asco_00020