close all open/close all

CDS information : Asco_00020


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction3,579 / 2,020 / - [in whole cluster]
3,579 / 2,020 / - [in contig]
Locationcomplement(2020..3579) [in whole cluster]
complement(2020..3579) [in contig]
TypeCDS
Length1,560 bp (519 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative poly(3-hydroxybutyrate) depolymerase
Product (GenBank)polyhydroxybutyrate depolymerase
Gene
Gene (GenBank)fkbU
EC number
Keyword
  • ethylmalonyl-CoA
Note
Note (GenBank)
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
Related Reference
ACC
P52090
PmId
[8269961] Cloning and characterization of the poly(hydroxyalkanoic acid)-depolymerase gene locus, phaZ1, of Pseudomonas lemoignei and its gene product. (Eur J Biochem. , 1993)
ACC
P12625
PmId
[2644188] Cloning, nucleotide sequence, and expression in Escherichia coli of the gene for poly(3-hydroxybutyrate) depolymerase from Alcaligenes faecalis. (J Bacteriol. , 1989)

close this sectionSequence

selected fasta
>putative poly(3-hydroxybutyrate) depolymerase [polyhydroxybutyrate depolymerase]
MQPPPFRGILTPLFPLSSSPPVGSLSRPGRRGVLTRLVAVVALVLGAALLGPAPTAHAAA
GLAKPGLTKADLTEVADFGTNPGRLNMYVYRPASLPAEPAVVFALHGCTQDAQGYADNSG
LLSFADRYGFLLVFAETTSSNNANRCFNWFQSSDNRRGQGEAASIRQMAAHTVSAYGADP
QRTYITGLSAGGAMTSVMLATYPDVFQAGAVVAGLPFGCATDVSSAYLCMNPGTDLTADQ
WARRVRDGYPSWSGPWPRVAIWHGDKDTTVAPRNADELRDQWTAVHGVSQTPDRTSVIGP
NSTRHEEYLAADGSVAVEVNRVPGIGHGTPVDPGTGAQQCGSTGAAYFLDSICSSYWITQ
FFGLSGSASDPGSLPAPSGLAATGATDTTISLTWKPVDGATDYAVHRDGAQITTSATTSY
TDTGLRAGTSHTYAVAARDADGKAGPLSGAVTAQTTGATAVCWTAGNYAHVQAGRATTSA
GYTYAKGSGQNMGLYNTFVTTTLKESPTGYFTVANDTCP
selected fasta
>putative poly(3-hydroxybutyrate) depolymerase [polyhydroxybutyrate depolymerase]
ATGCAGCCGCCGCCGTTCCGGGGAATCCTCACCCCGCTGTTCCCCCTCTCCTCCTCGCCG
CCGGTCGGGTCGTTGTCGCGTCCGGGACGGCGGGGGGTGCTCACCCGTCTCGTGGCCGTC
GTGGCCCTCGTACTCGGAGCGGCCCTGCTCGGCCCGGCGCCGACGGCCCACGCCGCGGCG
GGCCTGGCCAAGCCCGGTCTGACCAAGGCGGACCTGACCGAGGTCGCGGACTTCGGCACG
AACCCGGGCCGGCTGAACATGTACGTCTACCGGCCCGCGTCCCTGCCCGCGGAGCCGGCG
GTGGTGTTCGCCCTGCACGGTTGCACCCAGGACGCCCAGGGCTACGCCGACAACTCCGGC
CTGCTCTCATTCGCGGACCGCTATGGCTTCCTGCTCGTGTTCGCCGAGACCACGTCGTCG
AACAACGCGAACAGGTGCTTCAACTGGTTCCAGAGCAGCGACAACCGCAGGGGCCAGGGC
GAAGCCGCGTCGATCCGGCAGATGGCCGCTCACACCGTCTCCGCCTACGGCGCGGACCCC
CAGCGCACCTACATCACCGGGCTGTCCGCCGGCGGTGCCATGACGTCGGTGATGCTCGCC
ACCTATCCGGACGTCTTCCAGGCCGGCGCGGTCGTCGCCGGCCTGCCCTTCGGCTGTGCC
ACCGACGTCAGCAGCGCGTACCTGTGCATGAACCCCGGGACCGACCTGACCGCGGACCAG
TGGGCGCGGCGGGTCCGTGACGGCTACCCCTCGTGGTCGGGCCCGTGGCCGCGCGTGGCC
ATCTGGCACGGCGACAAGGACACCACCGTCGCGCCGCGCAACGCCGACGAGTTGCGCGAC
CAGTGGACCGCTGTGCACGGCGTGTCCCAGACGCCGGACCGTACCTCGGTGATCGGCCCG
AACTCCACCCGGCACGAGGAGTACCTGGCCGCGGACGGATCGGTGGCCGTGGAGGTGAAC
CGGGTGCCGGGCATCGGGCACGGCACCCCGGTCGATCCCGGCACCGGAGCACAGCAGTGC
GGCAGCACCGGCGCCGCCTACTTCCTGGACTCGATCTGTTCCAGCTACTGGATCACGCAG
TTCTTCGGCCTGAGCGGATCCGCCTCCGACCCCGGTTCGCTGCCCGCTCCGTCCGGCCTG
GCCGCCACCGGCGCCACCGACACCACCATCAGCCTGACCTGGAAACCCGTCGACGGCGCC
ACCGACTACGCCGTCCACCGCGACGGTGCCCAGATCACCACGTCCGCCACGACGTCGTAC
ACGGACACCGGCCTGAGGGCGGGCACATCGCACACCTACGCGGTCGCCGCCCGGGACGCG
GACGGCAAGGCCGGACCGCTCTCGGGCGCGGTCACCGCGCAGACGACCGGTGCCACGGCC
GTCTGCTGGACCGCCGGCAACTACGCTCACGTCCAGGCGGGCCGCGCCACGACGAGCGCC
GGTTACACCTACGCCAAGGGCTCCGGCCAGAACATGGGCCTGTACAACACCTTCGTCACG
ACCACCTTGAAAGAGTCGCCGACCGGCTACTTCACCGTCGCGAACGACACCTGTCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003961 Fibronectin, type III (Domain)
 [375-453]  PS50853
PS50853   FN3
 [364-458]  7.80000016938413e-13 SSF49265
SSF49265   FN_III-like
 [375-448]  4.20000000000001e-08 PF00041
PF00041   fn3
 [374-444]  5.50000546509999e-10 SM00060
SM00060   FN3
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-58]  PS51318
PS51318   TAT
IPR010126 Esterase, PHB depolymerase (Family)
 [87-297]  3.19999999999996e-70 TIGR01840
TIGR01840   Esterase_phb
IPR013783 Immunoglobulin-like fold (Domain)
 [376-449]  1.8e-11 G3DSA:2.60.40.10
G3DSA:2.60.40.10   Ig-like_fold
SignalP
 [1-58]  0.972 Signal
Bacteria, Gram-negative   
 [1-58]  0.704 Signal
Eukaryota   
 [1-58]  1 Signal
Bacteria, Gram-positive   
TMHMM
 [37-59]  Transmembrane (i-o)
Transmembrane 1