close all open/close all

CDS information : Asco_00030


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction4,496 / 3,969 / - [in whole cluster]
4,496 / 3,969 / - [in contig]
Locationcomplement(3969..4496) [in whole cluster]
complement(3969..4496) [in contig]
TypeCDS
Length528 bp (175 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)FkbR2
Gene
Gene (GenBank)fkbR2
EC number
Keyword
Note
Note (GenBank)
  • transcription regulator
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)

close this sectionSequence

selected fasta
>hypothetical protein [FkbR2]
MVEGWQGRYFEDFTTGDVYRHPLGRTVLETDNSWLTLLTQNTAPLHFDRHYSAGTTWGKP
LVDSTFTLALVTGQSVTDISQHVMANLGWDRVRLPNPVFEGDTIYSQSEVLNTRESASRP
DVGIISVRTIGYNQDGVIVITFERTLMVYRRGHGPRFAAVEPVWDERSRRAAGLH
selected fasta
>hypothetical protein [FkbR2]
GTGGTCGAGGGCTGGCAGGGCCGCTACTTCGAGGACTTCACCACCGGCGACGTGTACCGC
CACCCCCTGGGCCGCACGGTCCTGGAGACCGACAACTCCTGGCTCACGCTCCTGACGCAG
AACACCGCGCCGCTGCACTTCGACCGCCACTACTCGGCGGGCACCACCTGGGGCAAGCCG
CTGGTGGACTCCACCTTCACCCTCGCCCTGGTCACCGGGCAGAGCGTCACCGACATCTCC
CAGCATGTGATGGCCAACCTCGGCTGGGACCGGGTCAGGCTGCCGAACCCGGTCTTCGAG
GGCGACACCATCTACTCGCAGTCCGAGGTCCTGAACACCCGGGAGTCCGCCAGCCGACCT
GACGTAGGCATCATCAGCGTGCGCACCATCGGCTACAACCAGGACGGTGTCATCGTCATC
ACCTTCGAGCGGACACTGATGGTCTACCGCCGCGGACACGGACCCCGGTTCGCCGCGGTG
GAACCCGTCTGGGACGAGCGGTCCCGCAGGGCCGCGGGACTGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002539 MaoC-like dehydratase (Domain)
 [15-118]  1.4e-14 PF01575
PF01575   MaoC_dehydratas
SignalP No significant hit
TMHMM No significant hit