close all open/close all

CDS information : Asco_00040


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction5,488 / 4,595 / - [in whole cluster]
5,488 / 4,595 / - [in contig]
Locationcomplement(4595..5488) [in whole cluster]
complement(4595..5488) [in contig]
TypeCDS
Length894 bp (297 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LysR family transcriptional regulator
Product (GenBank)FkbR1
Gene
Gene (GenBank)fkbR1
EC number
Keyword
Note
Note (GenBank)
  • transcription regulator
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
Related Reference
ACC
P20668
PmId
[2548995] Positive regulation of glutamate biosynthesis in Bacillus subtilis. (J Bacteriol. , 1989)
[7559360] Mutations in GltC that increase Bacillus subtilis gltA expression. (J Bacteriol. , 1995)
[7559359] Sites required for GltC-dependent regulation of Bacillus subtilis glutamate synthase expression. (J Bacteriol. , 1995)

close this sectionSequence

selected fasta
>putative LysR family transcriptional regulator [FkbR1]
MEIRELQWFTALAEHEHVTITAERLNISQPTLSRAIRRLERRVGVPLFDRHQNRLRLNKY
GEVFRAHALRAISEVSGAEQRITALIDPDTGTVALGFLHSYGTWLVPDLLAGYRRLAPGT
TFELRGDAADAVVDDVRNSRLDLGLTSPRPAGDDVEWTPLRDEALCLLVPPGHRLARRRR
VRTAELADEAFVALEPVFGLRQITDRLCAAAGFVPRVVLESTELSTLRALVAAGLGVAVA
PLTGSPSGPGDHAVAVPLDDPQARRTVGVVTLAGGPRAPVVARFYDYVRSRAHAPHV
selected fasta
>putative LysR family transcriptional regulator [FkbR1]
ATGGAGATACGGGAGTTGCAGTGGTTCACGGCCTTGGCCGAGCACGAGCACGTGACGATC
ACCGCGGAACGGCTCAACATCTCCCAGCCGACCCTGTCCAGGGCCATCCGGCGGCTGGAG
CGACGAGTGGGCGTGCCGCTGTTCGACCGGCACCAGAACCGGCTCCGGCTCAACAAGTAC
GGCGAGGTCTTCCGCGCCCACGCCCTGCGCGCGATCAGTGAGGTCTCCGGCGCCGAGCAG
CGCATCACCGCCCTGATCGACCCCGACACCGGCACCGTGGCACTGGGTTTCCTGCACTCC
TACGGCACCTGGCTGGTGCCCGACCTCCTCGCCGGGTACCGCCGGCTGGCTCCCGGCACC
ACCTTCGAACTGCGCGGCGACGCCGCCGACGCCGTGGTCGACGACGTCCGCAACAGCAGG
CTGGACCTGGGGCTGACCAGCCCACGACCCGCCGGGGACGATGTGGAGTGGACACCACTG
CGGGACGAGGCACTGTGCCTGCTCGTCCCACCCGGACACCGGCTGGCCAGACGCCGCCGG
GTGCGGACCGCGGAGCTGGCCGATGAGGCGTTCGTGGCACTGGAGCCGGTCTTCGGACTG
CGCCAGATCACCGACCGGCTGTGCGCCGCGGCCGGATTCGTGCCGCGGGTCGTCCTGGAG
AGCACCGAGCTGAGCACGCTGCGGGCCCTGGTCGCCGCCGGCCTCGGTGTGGCCGTCGCC
CCCCTCACCGGCAGCCCGTCCGGGCCCGGTGACCACGCCGTCGCCGTGCCGCTCGACGAC
CCGCAGGCGCGGCGCACGGTCGGCGTGGTCACACTCGCCGGAGGACCACGCGCGCCAGTG
GTGGCGAGGTTCTACGACTACGTACGGTCCAGGGCTCATGCGCCGCACGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000847 Transcription regulator HTH, LysR (Domain)
 [18-29]  8.19999506482837e-09 PR00039 [29-39]  8.19999506482837e-09 PR00039 [39-50]  8.19999506482837e-09 PR00039
PR00039   HTHLYSR
 [1-58]  PS50931
PS50931   HTH_LYSR
 [3-62]  3.8e-20 PF00126
PF00126   HTH_1
IPR005119 LysR, substrate-binding (Domain)
 [89-292]  4.30000000000003e-47 PF03466
PF03466   LysR_substrate
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [1-84]  4.10000000000001e-24 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit