close all open/close all

CDS information : Asco_00050


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction5,601 / 6,818 / + [in whole cluster]
5,601 / 6,818 / + [in contig]
Location5601..6818 [in whole cluster]
5601..6818 [in contig]
TypeCDS
Length1,218 bp (405 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
ProductCoA-transferase family protein
Product (GenBank)FkbE
Gene
Gene (GenBank)fkbE
EC number
Keyword
Note
Note (GenBank)
  • L-carnitine dehydratase
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
Family/Domain
FD
IPR003673

close this sectionSequence

selected fasta
>CoA-transferase family protein [FkbE]
MSEPHPRPEQERPAGPLSGLLVVSLEQAVAAPFATRHLADLGARVIKIERPGSGDLARGY
DRTVRGMSSHFVWLNRGKESVQLDVRSPEGNRHLHALVDRADVLVQNLAPGAAGRLASAT
RSSRGATEADHLRTYPATAVPAATADRKAYDLLVQCEAGLVSITGTPETPSKVGLSIADI
CAGMYAYSGILTALLKRARTGRGSQLEVSMLEALGEWMGYAEYYTRYGGTAPARAGASHA
TIAPYGPFTTRDGQTINLGLQNEREWASFCGVVLQRPGLCDDPRFSGNADRVAHRTELDA
LVSEVTGTLTGEELVARLEEASIAYARQRTVREFSEHPQLRDRGRWAPFDSPVGALEGLI
PPVTFHGEHPRRLGRVPELGEHTESVLAWLAAPHSADREEAGHAE
selected fasta
>CoA-transferase family protein [FkbE]
ATGTCCGAGCCGCATCCTCGCCCTGAACAGGAACGCCCCGCCGGGCCCCTGTCCGGTCTG
CTCGTGGTTTCTTTGGAGCAGGCCGTCGCCGCTCCGTTCGCCACCCGCCACCTGGCGGAC
CTGGGCGCCCGTGTCATCAAGATCGAACGCCCCGGCAGCGGCGACCTCGCCCGCGGCTAC
GACCGCACGGTGCGTGGCATGTCCAGCCACTTCGTCTGGCTGAACCGGGGGAAGGAGAGC
GTCCAGCTCGATGTGCGCTCGCCGGAGGGCAACCGGCACCTGCACGCCTTGGTGGACCGG
GCCGATGTCCTGGTGCAGAATCTGGCACCCGGCGCCGCGGGCCGCCTGGCATCGGCCACC
AGGTCCTCGCGCGGAGCCACCGAGGCTGATCACCTGCGGACATATCCGGCTACGGCAGTA
CCGGCTGCTACCGCGGACCGCAAGGCGTACGACCTCCTGGTCCAGTGCGAAGCGGGGCTG
GTCTCCATCACCGGCACCCCCGAGACCCCGTCCAAGGTGGGCCTGTCCATCGCGGACATC
TGTGCGGGGATGTACGCGTACTCCGGCATCCTCACGGCCCTGCTGAAGCGGGCCCGCACC
GGCCGGGGCTCGCAGTTGGAGGTCTCGATGCTCGAAGCCCTCGGTGAATGGATGGGATAC
GCCGAGTACTACACGCGCTACGGCGGCACCGCTCCGGCCCGCGCCGGCGCCAGCCACGCG
ACGATCGCCCCCTACGGCCCGTTCACCACGCGCGACGGGCAGACGATCAATCTCGGGCTC
CAGAACGAGCGGGAGTGGGCTTCCTTCTGCGGTGTCGTGCTACAACGCCCCGGTCTCTGC
GACGACCCGCGCTTTTCCGGCAACGCCGACCGGGTGGCGCACCGCACCGAGCTCGACGCC
CTGGTGAGCGAGGTGACGGGCACGCTCACCGGCGAGGAACTGGTGGCGCGGCTGGAGGAG
GCGTCGATCGCCTACGCACGCCAGCGCACCGTGCGGGAGTTCAGCGAACACCCCCAACTG
CGTGACCGTGGACGCTGGGCTCCGTTCGACAGCCCGGTCGGTGCGCTGGAGGGCCTGATC
CCCCCGGTCACCTTCCACGGCGAGCACCCGCGGCGGCTGGGCCGGGTCCCGGAGCTGGGC
GAGCATACCGAGTCCGTCCTGGCGTGGCTGGCCGCGCCCCACAGCGCCGACCGCGAAGAG
GCCGGCCATGCCGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003673 CoA-transferase family III (Family)
 [81-269]  4.30000000000003e-41 PF02515
PF02515   CoA_transf_3
IPR023606 CoA-transferase family III domain (Domain)
 [13-390]  1.79999754022378e-102 SSF89796
SSF89796   CoA-Trfase_fam_III
 [8-326]  4.89999999999996e-84 G3DSA:3.40.50.10540
G3DSA:3.40.50.10540   CoA-Trfase_fam_III
SignalP
 [1-30]  0.367 Signal
Bacteria, Gram-positive   
 [1-30]  0.781 Signal
Eukaryota   
TMHMM No significant hit