close all open/close all

CDS information : Asco_00060


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction6,808 / 8,052 / + [in whole cluster]
6,808 / 8,052 / + [in contig]
Location6808..8052 [in whole cluster]
6808..8052 [in contig]
TypeCDS
Length1,245 bp (414 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)FkbF
Gene
Gene (GenBank)fkbF
EC number
Keyword
Note
Note (GenBank)
  • similar to Rhizobium trifolii MatC; dicarboxylate carrier
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)

close this sectionSequence

selected fasta
>hypothetical protein [FkbF]
MPNELTGVLILAAVFLLAGVRGLNMGLLALVATFLLGVVALDRTPDEVLAGFPASMFLVL
VAVTFLFGIARVNGTVDWLVRVAVRAVGARVGAVPWVLFGLAALLCATGAASPAAVAIVA
PISVAFAVRHRIDPLYAGLMAVNGAAAGSFAPSGILGGIVHSALEKNHLPVSGGLLFAGT
FAFNLAVAAVSWLVLGRRRLEPHDLDEDTDPTEGDPASRPGAEHVMTLTAMAALVLGTTV
LSLDTGFLALTLAALLALLFPRTSQQATKEIAWPVVLLVCGIVTYVALLQELGIVDSLGK
MIAAIGTPLLAALVICYVGGVVSAFASTTGILGALMPLSEPFLKSGAIGTTGMVMALAAA
ATVVDASPFSTNGALVVANAPERLRPGVYQGLLWWGAGVCALAPAAAWAAFVVA
selected fasta
>hypothetical protein [FkbF]
ATGCCGAATGAACTCACCGGAGTCCTGATCCTGGCCGCCGTGTTCCTGCTCGCCGGCGTA
CGGGGGCTGAACATGGGCCTGCTCGCGCTGGTCGCCACCTTTCTGCTCGGGGTGGTCGCA
CTCGACCGAACGCCGGACGAGGTGCTGGCGGGTTTCCCCGCGAGCATGTTCCTGGTGCTG
GTCGCCGTCACGTTCCTCTTCGGGATCGCCCGCGTCAACGGCACGGTGGACTGGCTGGTA
CGTGTCGCGGTGCGGGCGGTGGGGGCCCGGGTGGGAGCCGTCCCCTGGGTGCTCTTCGGC
CTGGCGGCACTGCTCTGCGCGACAGGCGCGGCCTCGCCCGCGGCGGTGGCGATCGTGGCG
CCGATCAGCGTCGCGTTCGCCGTCAGGCACCGCATCGATCCGCTGTACGCCGGACTGATG
GCGGTGAACGGGGCCGCAGCCGGCAGTTTCGCCCCCTCCGGGATCCTGGGCGGCATCGTC
CACTCGGCGCTGGAGAAGAACCATCTGCCCGTCAGCGGCGGGCTGCTCTTCGCAGGCACC
TTCGCCTTCAACCTGGCGGTCGCCGCGGTGTCATGGCTCGTCCTCGGGCGCAGGCGCCTC
GAACCACATGACCTGGACGAGGACACCGATCCCACGGAAGGGGACCCGGCTTCCCGCCCC
GGCGCGGAACACGTGATGACGCTGACCGCGATGGCCGCGCTGGTGCTGGGAACCACGGTC
CTCTCCCTGGACACCGGCTTCCTGGCCCTCACCTTGGCGGCGTTGCTGGCGCTGCTCTTC
CCGCGCACCTCCCAGCAGGCCACCAAGGAGATCGCCTGGCCCGTGGTGCTGCTGGTATGC
GGGATCGTGACCTACGTCGCCCTGCTCCAGGAGCTGGGCATCGTGGACTCCCTGGGGAAG
ATGATCGCGGCGATCGGCACCCCGCTGCTGGCCGCCCTGGTGATCTGCTACGTGGGCGGT
GTCGTCTCGGCCTTCGCCTCGACCACCGGGATCCTCGGTGCCCTGATGCCGCTGTCCGAG
CCGTTCCTGAAGTCCGGTGCCATCGGGACGACCGGCATGGTGATGGCCCTGGCGGCCGCG
GCGACCGTGGTGGACGCGAGTCCCTTCTCCACCAATGGTGCTCTGGTGGTGGCCAACGCT
CCCGAGCGGCTGCGGCCCGGCGTGTACCAGGGGTTGCTGTGGTGGGGCGCCGGGGTGTGC
GCACTGGCTCCCGCGGCCGCCTGGGCGGCCTTCGTGGTGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009827 Dicarboxylate carrier MatC N-terminal (Domain)
 [1-149]  2.59999999999998e-63 PF07158
PF07158   MatC_N
SignalP
 [1-22]  0.995 Signal
Eukaryota   
 [1-18]  0.529 Signal
Bacteria, Gram-negative   
TMHMM
 [7-38]  Transmembrane (i-o) [48-70]  Transmembrane (o-i) [82-104]  Transmembrane (i-o) [109-128]  Transmembrane (o-i) [141-163]  Transmembrane (i-o) [173-195]  Transmembrane (o-i) [234-256]  Transmembrane (i-o) [271-289]  Transmembrane (o-i) [302-336]  Transmembrane (i-o) [356-378]  Transmembrane (o-i) [391-413]  Transmembrane (i-o)
Transmembrane 11