close all open/close all

CDS information : Asco_00070


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction8,156 / 8,824 / + [in whole cluster]
8,156 / 8,824 / + [in contig]
Location8156..8824 [in whole cluster]
8156..8824 [in contig]
TypeCDS
Length669 bp (222 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative O-methyltransferase
Product (GenBank)FkbG
Gene
Gene (GenBank)fkbG
EC number2.1.1.-
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • O-methyl transferase
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)
Related Reference
ACC
Q8KUG5
NITE
Ansam_00190
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
P28034
PmId
[1894629] Molecular cloning, induction and taxonomic distribution of caffeoyl-CoA 3-O-methyltransferase, an enzyme involved in disease resistance. (J Biol Chem. , 1991)
[9037150] Structure of the parsley caffeoyl-CoA O-methyltransferase gene, harbouring a novel elicitor responsive cis-acting element. (Plant Mol Biol. , 1997)

close this sectionSequence

selected fasta
>putative O-methyltransferase [FkbG]
MANQITLSDTLLAYVRKVSLRDDEVLSRLRAQTAELPGGGVLPVQAEEGQFLEFLVRLTG
ARQVLEIGTYTGYSTLCLARGLAPGGRVVTCDVMPKWPEVGERYWEEAGVADRIDVRIGD
ARTVLTGLLDEAGAGPESFDMVFIDADKAGYPAYYEAALPLVRRGGLIVVDNTLFFGRVA
DEAVQDPDTVAVRELNAALRDDDRVDLAMLTTADGVTLLRKR
selected fasta
>putative O-methyltransferase [FkbG]
ATGGCTAATCAGATAACCCTGTCCGACACGCTGCTCGCTTACGTACGGAAGGTGTCCCTG
CGCGATGACGAGGTGCTGAGCCGGCTGCGCGCGCAGACGGCCGAGCTGCCGGGCGGTGGC
GTACTGCCGGTGCAGGCCGAGGAGGGACAGTTCCTCGAGTTCCTGGTGCGGTTGACCGGC
GCGCGTCAGGTGCTGGAGATCGGGACGTACACCGGCTACAGCACGCTCTGCCTGGCCCGC
GGATTGGCGCCCGGGGGCCGTGTGGTGACGTGCGATGTCATGCCGAAGTGGCCCGAGGTG
GGCGAGCGGTACTGGGAGGAGGCCGGGGTTGCCGACCGGATCGACGTCCGGATCGGCGAC
GCCCGGACCGTCCTCACCGGGCTGCTCGACGAGGCGGGCGCGGGGCCGGAGTCGTTCGAC
ATGGTGTTCATCGACGCCGACAAGGCCGGCTACCCCGCCTACTACGAGGCGGCGCTGCCG
CTGGTACGCCGCGGCGGGCTGATCGTCGTCGACAACACGCTGTTCTTCGGCCGGGTGGCC
GACGAAGCGGTGCAGGACCCGGACACGGTCGCGGTACGCGAACTCAACGCGGCACTGCGC
GACGACGACCGGGTGGACCTGGCGATGCTGACGACGGCCGACGGCGTCACCCTGCTGCGG
AAACGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002935 O-methyltransferase, family 3 (Family)
 [17-222]  7.79999999999999e-75 PF01596
PF01596   Methyltransf_3
SignalP
 [1-33]  0.05 Signal
Bacteria, Gram-negative   
 [1-20]  0.14 Signal
Eukaryota   
TMHMM No significant hit