close all open/close all

CDS information : Asco_00080


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction9,884 / 8,802 / - [in whole cluster]
9,884 / 8,802 / - [in contig]
Locationcomplement(8802..9884) [in whole cluster]
complement(8802..9884) [in contig]
TypeCDS
Length1,083 bp (360 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative glyceroyl-ACP biosynthesis protein
putative 1,3-bisphospho-D-glycerate phosphatase/glyceroyltransferase
Product (GenBank)FkbH
Gene
Gene (GenBank)fkbH
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)
Related Reference
ACC
Q1G727
NITE
Oxzol_00080
PmId
[16895402] The bifunctional glyceryl transferase/phosphatase OzmB belonging to the HAD superfamily that diverts 1,3-bisphosphoglycerate into polyketide biosynthesis. (J Am Chem Soc. , 2006)
ACC
Q8KUG4
NITE
Ansam_00180
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
[17076505] On the biosynthetic origin of methoxymalonyl-acyl carrier protein, the substrate for incorporation of "glycolate" units into ansamitocin and soraphen A. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>putative glyceroyl-ACP biosynthesis protein [FkbH]
MTIVKCLVWDLDNTLWRGTVLEDDEVVLTDEIREVITTLDDRGILQAVASKNDHDLAWER
LERLGVAEYFVLARIGWGPKSQSVREIATELNFAPTTIAFIDDQPAERAEVAFHLPEVRC
YPAEQAATLLSLPEFSPPVSTVDSRRRRLMYQAGFARDQAREAYSGPDEDFLRSLDLSMT
IAPAGEEELSRVEELTLRTSQMNATGVHYSDADLRACFTDPAHEVLVVTMGDRFGPHGAV
GIILLEKKPSTWHLKLLATSCRVVSFGAGATILNWLTDQGARAGAHLVADFRRTDRNRMM
EIAYRFAGFADSDCPCVSEVAGASAAGVERLHLEPSARPAPTTLTLTAADIAPVTVSAAG
selected fasta
>putative glyceroyl-ACP biosynthesis protein [FkbH]
ATGACCATTGTCAAGTGTCTGGTCTGGGACCTGGACAACACCTTGTGGCGGGGCACCGTG
CTGGAGGACGACGAGGTGGTCCTCACCGACGAGATCCGCGAGGTGATCACCACGCTCGAC
GACCGCGGCATCCTCCAGGCGGTGGCGAGCAAGAACGACCACGACCTCGCGTGGGAGCGT
CTGGAACGCCTCGGTGTGGCGGAGTACTTCGTGCTGGCCCGCATCGGATGGGGGCCGAAG
TCGCAGTCCGTCCGCGAGATCGCCACGGAGCTGAACTTCGCACCGACCACGATCGCGTTC
ATCGACGACCAGCCCGCCGAGCGTGCCGAGGTGGCGTTCCACCTGCCCGAGGTGCGGTGC
TACCCGGCCGAGCAGGCGGCCACGCTCCTGTCGCTGCCGGAGTTCAGCCCGCCGGTGTCC
ACGGTCGACTCGCGTCGGCGCCGCCTGATGTACCAGGCGGGTTTCGCGCGCGACCAGGCC
CGGGAGGCGTACTCCGGTCCCGACGAGGACTTCCTGCGCTCGCTCGACCTCTCCATGACG
ATCGCACCCGCGGGGGAGGAGGAACTCAGCCGCGTCGAGGAACTGACGCTGCGGACCAGC
CAGATGAACGCGACCGGCGTGCACTACTCCGACGCCGACCTGCGCGCGTGCTTCACCGAT
CCCGCCCATGAGGTCCTCGTCGTCACCATGGGCGACCGCTTCGGCCCGCACGGCGCCGTC
GGCATCATCCTGCTGGAGAAGAAGCCGTCGACGTGGCACCTGAAACTGCTCGCCACGTCC
TGCCGGGTCGTGTCGTTCGGTGCCGGTGCGACGATCCTGAACTGGCTCACGGACCAGGGC
GCCCGCGCGGGGGCGCACCTGGTGGCGGACTTCCGGCGTACGGACCGCAACCGCATGATG
GAGATCGCCTACCGGTTCGCGGGCTTCGCGGACTCCGACTGCCCCTGCGTGTCCGAGGTG
GCGGGCGCTTCCGCCGCCGGCGTCGAACGCCTGCATCTGGAGCCCTCCGCGAGGCCCGCG
CCGACGACGCTGACGCTGACCGCCGCCGACATCGCCCCGGTCACCGTTTCCGCAGCAGGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010033 HAD-superfamily phosphatase, subfamily IIIC (Domain)
 [5-114]  1.5e-24 TIGR01681
TIGR01681   HAD-SF-IIIC
IPR010037 FkbH domain (Domain)
 [2-313]  TIGR01686
TIGR01686   FkbH
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [178-288]  1.60000065022528e-06 SSF55729
SSF55729   Acyl_CoA_acyltransferase
 [179-289]  7.5e-06 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
IPR023214 HAD-like domain (Domain)
 [4-106]  4.9e-11 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
 [1-105]  3.29999802154459e-16 SSF56784
SSF56784   HAD-like_dom
SignalP No significant hit
TMHMM No significant hit