close all open/close all

CDS information : Asco_00090


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction10,995 / 9,895 / - [in whole cluster]
10,995 / 9,895 / - [in contig]
Locationcomplement(9895..10995) [in whole cluster]
complement(9895..10995) [in contig]
TypeCDS
Length1,101 bp (366 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative oxidoreductase
Product (GenBank)FkbI
Gene
Gene (GenBank)fkbI
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • acyl CoA dehydrogenase
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
[14623185] Crystal structure of an Acyl-ACP dehydrogenase from the FK520 polyketide biosynthetic pathway: insights into extender unit biosynthesis. (J Mol Biol. , 2003)
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)
Related Reference
ACC
Q8KUG3
NITE
Ansam_00170
PmId
[11960423] Identification of a set of genes involved in the formation of the substrate for the incorporation of the unusual "glycolate" chain extension unit in ansamitocin biosynthesis. (J Am Chem Soc. , 2002)
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)

close this sectionSequence

selected fasta
>putative oxidoreductase [FkbI]
MPERDALLTDLVGDRAAEWDTSGELPRDLLVRLGADGLLCAEVAAEHGGLGLGSRENGEF
TAHVGSLCSSLRSVMTSQGMAAWTVQRLGDAGQRATFLKELTSGKLAAVGFSERQAGSDL
SAMRTRVRLDGDTAVVDGHKVWTTAAAYADHLVVFGLQEDGSGAVVVVPADTPGVRVERV
PKPSGCRAAGHADLHLDQVRVPAGAVLAGSGASLPMLVAASLAYGRKSVAWGCVGILRAC
RTAAVAHARTREQFGRPLGDHQLVAGHIADLWTAEQIAARVCEYASDHWDEGSPEMVPAT
ILAKHVAAERAAAGAATAAQVLASAGAREGHVVERAYRDAKLMEIIEGSSEMCRVMLAQH
ALALPA
selected fasta
>putative oxidoreductase [FkbI]
ATGCCTGAGCGTGACGCGCTGCTGACCGACCTTGTCGGTGACCGGGCCGCCGAGTGGGAC
ACGTCCGGCGAACTGCCGCGCGACCTGCTCGTCCGGCTCGGCGCCGACGGCCTGCTCTGC
GCGGAAGTGGCGGCCGAGCACGGCGGTCTGGGACTCGGCAGCCGGGAGAACGGCGAGTTC
ACCGCACACGTCGGCAGCCTCTGCAGTTCGCTGCGCAGTGTCATGACGTCGCAGGGCATG
GCCGCGTGGACCGTGCAGCGGCTCGGCGACGCCGGTCAGCGGGCGACCTTCCTGAAGGAG
CTGACCAGCGGGAAACTCGCGGCCGTCGGCTTCAGTGAGCGGCAGGCGGGCAGCGATCTG
TCGGCGATGCGGACGCGGGTTCGGCTCGACGGGGACACCGCTGTCGTCGACGGCCACAAG
GTCTGGACGACTGCCGCCGCCTACGCGGACCACCTGGTCGTCTTCGGTCTCCAGGAGGAT
GGTTCCGGTGCGGTGGTGGTCGTGCCCGCCGACACCCCCGGCGTACGCGTCGAGCGCGTC
CCGAAGCCGTCCGGCTGCCGCGCCGCCGGCCACGCCGATCTGCACCTGGACCAGGTGCGT
GTGCCGGCCGGCGCGGTCCTGGCCGGCTCCGGCGCGTCACTGCCGATGCTGGTCGCGGCG
TCACTCGCCTACGGGCGCAAGTCGGTCGCCTGGGGCTGCGTCGGGATCCTGCGGGCCTGC
CGCACCGCCGCGGTGGCCCACGCCCGGACCCGGGAGCAGTTCGGCCGGCCGCTCGGCGAC
CACCAACTCGTCGCCGGGCACATCGCCGACCTGTGGACCGCGGAGCAGATCGCGGCCCGC
GTGTGCGAGTACGCCAGCGACCACTGGGACGAGGGCTCGCCCGAGATGGTGCCCGCGACG
ATCCTGGCCAAGCACGTCGCCGCCGAACGAGCCGCCGCCGGGGCCGCGACCGCCGCACAG
GTGCTCGCGTCGGCAGGCGCGAGAGAGGGACACGTCGTCGAACGGGCGTACCGCGACGCC
AAGCTCATGGAGATCATCGAGGGCAGCAGCGAGATGTGCCGGGTGATGCTGGCCCAGCAC
GCGCTGGCGCTCCCGGCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [220-362]  8.30000000000004e-28 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [108-156]  1.2e-13 PF02770
PF02770   Acyl-CoA_dh_M
 [108-200]  1.5e-27 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [13-105]  6.1e-12 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [201-365]  2.1e-35 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [210-365]  7.6999848053369e-33 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [3-212]  1.40000506907309e-50 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [9-105]  2.7e-23 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit