close all open/close all

CDS information : Asco_00100


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction11,248 / 10,988 / - [in whole cluster]
11,248 / 10,988 / - [in contig]
Locationcomplement(10988..11248) [in whole cluster]
complement(10988..11248) [in contig]
TypeCDS
Length261 bp (86 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl carrier protein
Product (GenBank)FkbJ
Gene
Gene (GenBank)fkbJ
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • ACP
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)
Related Reference
ACC
Q8KUG2
NITE
Ansam_00160
PmId
[11960423] Identification of a set of genes involved in the formation of the substrate for the incorporation of the unusual "glycolate" chain extension unit in ansamitocin biosynthesis. (J Am Chem Soc. , 2002)
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
Q9XBU6
PmId
[16983083] Hydroxymalonyl-acyl carrier protein (ACP) and aminomalonyl-ACP are two additional type I polyketide synthase extender units. (Proc Natl Acad Sci U S A. , 2006)

close this sectionSequence

selected fasta
>putative acyl carrier protein [FkbJ]
MTAPVKDDPVAHALVAFLKTKTRSDWPVDRDLFAEGGLTSLFAMELVVYLEKTFDVTIAG
PDLQLANFRTVESMVALVHRLRAVDA
selected fasta
>putative acyl carrier protein [FkbJ]
ATGACCGCACCCGTCAAGGACGACCCCGTCGCGCACGCGTTGGTCGCGTTCCTCAAGACG
AAGACCAGGTCGGACTGGCCCGTGGACCGCGACCTGTTCGCGGAGGGCGGCCTCACGTCG
CTGTTCGCGATGGAACTGGTCGTGTACCTGGAGAAGACGTTCGACGTCACGATCGCCGGC
CCGGACCTCCAGCTCGCGAACTTCCGTACCGTCGAGTCCATGGTCGCACTCGTCCACCGG
CTGCGGGCCGTCGATGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003231 Acyl carrier protein (ACP) (Family)
 [37-80]  PD000887
PD000887   PD000887
IPR009081 Acyl carrier protein-like (Domain)
 [11-80]  2.5e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [19-78]  1.2e-07 PF00550
PF00550   PP-binding
 [2-82]  4.60000044330862e-12 SSF47336
SSF47336   ACP_like
 [6-79]  PS50075
PS50075   ACP_DOMAIN
SignalP
 [1-24]  0.115 Signal
Eukaryota   
TMHMM No significant hit