close all open/close all

CDS information : Asco_00120


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction13,151 / 12,114 / - [in whole cluster]
13,151 / 12,114 / - [in contig]
Locationcomplement(12114..13151) [in whole cluster]
complement(12114..13151) [in contig]
TypeCDS
Length1,038 bp (345 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative lysine cyclodeaminase
Product (GenBank)FkbL
Gene
Gene (GenBank)fkbL
EC number
Keyword
  • L-pipecolate
Note
Note (GenBank)
  • lysine cyclodeaminase
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
Related Reference
ACC
Q54304
NITE
Rapam_00190
PmId
[9473033] Mutational biosynthesis of novel rapamycins by a strain of Streptomyces hygroscopicus NRRL 5491 disrupted in rapL, encoding a putative lysine cyclodeaminase. (J Bacteriol. , 1998)
[16536560] Biosynthesis of pipecolic acid by RapL, a lysine cyclodeaminase encoded in the rapamycin gene cluster. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>putative lysine cyclodeaminase [FkbL]
MQTRVLRQRDIKRILSVIGRDVMMDRLISELHDGFAALGRGEFAEAPPRTGFVRGGDIPG
VIEFMPYRVPGVGVTMKTVSYSPHNYPRFRLPTIVGTMSRLDDDSGSLTALADAGVITAM
RTGAVAAVASRLLARSDSATLTLIGAGAQAVTQAHALSRVLPIERILVSDTDPGHAASFA
DRIAFLGLPVKVTDPAEAAAAADVLSTVTSVPSGKGPVLPAEPRLPHLHVNAIGADEPGK
TELPKTLLDDAFICVDHPGQARAEGEYQQLPDRELGPSLAALCAAPDTAADHRDSLSVLD
STGSAFADHIAFDVLLGFADELGLGRKDAIGSTPEDVLDPYSLPW
selected fasta
>putative lysine cyclodeaminase [FkbL]
ATGCAGACCAGGGTCCTGCGCCAACGTGACATCAAGCGGATTCTCTCCGTGATCGGCCGC
GACGTGATGATGGACCGGCTGATCAGCGAGCTGCACGACGGGTTCGCCGCGCTCGGCCGC
GGCGAGTTCGCCGAGGCGCCGCCGCGTACCGGATTCGTCCGCGGCGGCGACATTCCCGGC
GTCATCGAGTTCATGCCGTACCGGGTCCCCGGTGTCGGCGTGACCATGAAGACGGTTTCG
TACAGTCCGCACAACTATCCGCGCTTCCGGCTGCCGACGATCGTCGGCACGATGTCGCGC
CTCGACGACGACAGCGGCAGTCTGACCGCCCTCGCCGACGCAGGCGTGATCACCGCGATG
CGGACCGGCGCGGTCGCCGCCGTCGCGAGCCGGCTGCTGGCCCGGTCCGACAGCGCCACG
CTCACGCTGATCGGCGCGGGCGCACAGGCGGTGACCCAGGCGCACGCGCTCAGCAGGGTC
CTGCCCATCGAGCGGATCCTGGTCAGCGACACCGACCCCGGCCACGCGGCGTCGTTCGCG
GACCGCATCGCGTTCCTCGGACTGCCGGTCAAGGTGACCGATCCGGCGGAGGCCGCCGCC
GCCGCGGATGTCCTGTCCACCGTCACCTCGGTGCCCTCGGGCAAAGGGCCGGTGCTGCCC
GCCGAGCCGCGGCTGCCGCACCTGCATGTGAACGCCATCGGCGCCGACGAGCCGGGCAAG
ACCGAACTGCCGAAGACCCTGCTCGACGACGCGTTCATCTGCGTCGACCATCCGGGGCAG
GCCCGCGCCGAGGGCGAGTACCAGCAACTGCCGGACCGCGAGCTCGGCCCGTCGCTGGCG
GCCCTGTGCGCGGCACCGGACACCGCGGCGGACCACCGGGACAGCCTGAGCGTCCTCGAC
TCGACGGGCAGCGCGTTCGCCGACCACATCGCGTTCGACGTGCTGCTCGGCTTCGCCGAC
GAACTCGGCCTCGGCCGCAAGGACGCGATCGGGTCGACCCCGGAAGACGTCCTCGACCCG
TACTCGCTGCCATGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003462 Ornithine cyclodeaminase/mu-crystallin (Family)
 [10-322]  4.40000000000003e-94 PF02423
PF02423   OCD_Mu_crystall
 [1-331]  2.49999811956465e-26 PIRSF001439
PIRSF001439   CryM
IPR016040 NAD(P)-binding domain (Domain)
 [135-303]  1.6e-41 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit