close all open/close all

CDS information : Asco_00130


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction23,989 / 13,214 / - [in whole cluster]
23,989 / 13,214 / - [in contig]
Locationcomplement(13214..23989) [in whole cluster]
complement(13214..23989) [in contig]
TypeCDS
Length10,776 bp (3,591 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)FkbC
Gene
Gene (GenBank)fkbC
EC number
Keyword
Note
Note (GenBank)
  • PKS modules 5 and 6
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)

close this sectionPKS/NRPS Module

5 methylmalonyl-CoA
6 methylmalonyl-CoA
KS33..397
AT528..800
DH874..1036
KR1298..1463
ACP1555..1625
KS1646..2008
AT2139..2411
DH2485..2651
ER2907..3193
KR3203..3364
ACP3443..3513

close this sectionSequence

selected fasta
>polyketide synthase [FkbC]
MAENDLIEALRTSVKDNAQLRRENTALRAAANEPLAVVGMACRLPGGVTSPEELWQLVAD
GRDAIGDFPTDRGWDVAALHAAAESATGRAGALAGAADFDAAFFGISPREATALDPQQRI
LLEIAWEALEHAGIVPDTLRGSDTGVFVGGFYYGYGTGADLGGFGAYSTQPAVLAGRLSY
FFGMEGPAVTVDTACSSSLVALHQAGQALRTGECSLALVGGVTVMASPQTFVEFSRQGGV
APDGRCKAFADAADGTGFAEGAGVLVVEKLSDAERNGHTVLAVVRSSAVNQDGASNGISA
PNGPSQQRVIRQALHKAGLAPADVDVVEAHGTGTTLGDPIEAHAILATYGQEREVPLLLG
SLKSNIGHAQAAAGVAGVIKMVMAMRYGIAPKTLHVDEPSSHVDWTEGAVELLTEARAWP
DAGRPRRAGVSAFGVSGTNAHVILEGVPGPSRGESAVDGLVPLPVSARSEVSLRGQVERL
EGYLRGGGVDVAAVAQGLVRERAVFGHRAVLLGDARVMGVAVDQPRTVFVFPGQGAQWVG
MGVELMACSAVFAARMEECARALLPHTGWDVREMLARPDVAERVEVVQPASWAVAVSLAA
LWQAHGVVPDAVVGHSQGEIAAACVAGALSLEDAARVVALRSQVIAGRLAGRGAMASVAL
PAGEVDLVEGVWIAARNGPSSTVVAGDPSAVEEVVTRYEAEGVRVRRIAVDYASHTPHVE
AIEDELAEVLEGISGGTGSVAWWSTVDSAWVTEPVDEGYWYRNLRRPVALDAAVAELDGS
VFVECSAHPVLLPAMEQAHTVASLRTGDGGWERWLTALAQAWTLGTAVDWDTVVEPVPGR
LLDLPTYAFEHRRYWLEAAGATDLSAAGLTGAAHPMLAAVTALPADDGGGVVLTGRISLR
THPWLADHAVRGTVLLPGTAFVELVIRAGDETGCGVVDELVIETPLVVPVTGAVDVSVTV
EGADEAGRRRVTVHARTEGTDSWTRHASGTLGRAGSVAAVPPPAWPPPGARRVDVSAFYE
RLAETGYSYGPAFQGLRTAWRDGETLYAEVEIAGEQADDTPHYGVHPALFDAALHVTCLP
LLAEQEAEVRLPFSWSGVRFHTTGATTLRVTITQGPDGAAVHATDPVGQPVVTVAALTAR
PVNVDGDAAVVRNSLYGLSWTELPTPGPGPADAVHIVSALPEPGADVLDETYRLTEFVLG
ELHRVIAEDGPAETTLVVRIDAGPVGGAVAGLVRSAQAEHPGRFVLVETGTDTPIEALAA
ATTLAEPYVRVTDGRYEAPRFTRTAAAETPEPLLDPDGTVVITGGSGVLAGLLARHLVAE
HGARHLLLLSRSEPPADTPGVHIRCDVADRDQLAAALAAAGRPLTAVFHTAAVLDDGVTT
ALTPERLATTLRPKADGAWHLHELTRDADLRSFVLYSSVAGIMGGRGQGNYSAANGFLDG
LATLRHAEGLPALSLAWGLWADDSGLTGSMSGTNRTRVRRGGFRPMSAGVGMRLLEAAAG
TGTAFAVAATMDLTAHTSPLFADLRRAVSRPAAATAVPLADRLGTMSGAERDTALLALVR
DNAAAVLGHADAADVSADAAFKELGIDSLTAVELRNRLAAATGVRLPATLVFDYPTPRAI
ASRLDEALVGGAAPVAVPTAAATRDEPLAIVGMACRLPGGVTSPDDLWRMVDSGGDAVTG
FPADRGWDPSGLTGGSDTDRGGFLSDAAGFDAAFFGISPREARAMDPQQRILLETTWEAF
ESAGIVPGTLRGSDTGVFMGAFSYGYGVGADLDGFGSIGMQPSVLTGRISYFYGLQGPAF
TVDTACSSSLVALHQAGHALRHGECSLALVGGVTVMATPTGFVEFQQQGGLSPDGRCRAF
ADAANGTGWAEGAGVLVLERLSDAERNGHTVLAVVRGSAVNQDGASNGLSAPNGPSQQRV
IQQALVNAGLRAADVDVVEAHGTGTTLGDPIEAQAILATYGQEREVPLLLGSLKSNIGHA
QAAAGVAGVIKMVMAMRYGIAPKTLHVDEPSSHVDWSAGAVELLTEARPWPESDRAPHAG
VSSFGVSGTNAHVILEGVPGPSRGESVVDGLVPLPVSARGEVSLRGQVERLEGYLRGGGV
DVAAVAQGLVRERAVFGHRAVLLGDARVTGVAVDQPRTVFVFPGQGAQWVGMGVELMAHS
AVFAARMEECAQALLPHTGWDVREMLARPDVAERVEVVQPASWAVAVSLAALWQAHGVVP
DAVIGHSQGEIAAACVAGALSLEDAARVVALRSQVIAARLAGRGAMASVALPAGEVGLVE
GVWIAARNGPASTVVAGDPSAVEEVVARYEAEGVRVRRIAVDYASHTPHVEAIEDELAKV
LEGVAGKAASVAWWSTVDSAWVTEPVDEGYWYRNLRRPVALDAAVAELDGSVFVECSAHP
VLLPAMEQAHTVASLRTGDGGWERWLTALAQAWTLGTAVDWDTVVEPVPGRLLDLPTYAF
EHRRYWLEAAGATDLSAAGLTGAAHPMLAAVTALPADDGGVVLTGRISLRTHPWLADHAV
RGTVLLPGTAFVELVIRAGDETGCGIVDELVIESPLVVPVTAAVDVSVTVEGADEAGRRP
VTVHARTEGTGSWTRHASGTLTPDTPDTPGVVGVEPFSQWPPVTAVAVDVSGFYDELRDA
GYEYGSAFQGLRAAWRDGDTVYAEVALPDEQAAEADGFGVHPALLDAALHAVALTTPDDS
AAGLPFAWKGARFVATGSAMLRAVITRDGDELSLRVADSAGQLVAEIRTVRTRPLSPPVG
TGLMRLTWIEVAAPTDVPATDVDVITLPAADGDDPVAETRALTTRLLTALTGSGGDLLVH
TTAGLATGAAAGLLRAAQAEQPGRFVHVETESGVTLAPEQQRIAVALGEPRLRLRGGRFE
AARLTRVPEPLTVPDSDTWLIRPARTGTLDGLTAADSAEPRRPLAPAEVRIGVRAAGLNF
RDVLIALGTYPGQGVLGGEAAGIVLETGADVSGLAPGDRVFGLVGTGFGPTVIADHRMLG
RMPDGWTFPQAASVMTAFATAWYGLVDLAGLRPGEKVLIHAATGGVGSAARQIARHLGAE
VYATTSAAKRHLVDLDGAHLADSRSTAFADAFPPVDVVLNSLTGELLDASVGLLAPGGRF
IEMGKTDIRHAVQRPFDLMDAGPDRLKEIIAELLGLFARGVLHPLPVTVHDMRQVREALA
TMSRGEHTGKIVLTVPRPLDPEGAVVITGGSGTLAGILARHLNHPHTYLLSRTPPPDTTP
GTHLPCDVGDPHQLATTLAHIPQPLTAVFHTAGTLDDALLDNLTPDRIDTVLKPKADAAW
HLHRLTRDTDLAAFVVYSSAAGVLGTPGQGNYAAANAFLDALAEHRRAQGLPGLSIAWGL
WDQASGLTADLTDADRRRMRKGGASALTAEQGMRMYDAAVHTGTGSVVAVAGDLPPDLPL
LRGRPKPSARRSARNEQERPTDLLALVRQKAAAVLGHADPEDIPEDAAFRELGVDSLIAV
QLRNGLNEATGLRLSATLVFDYPSPRALADRIGELLSPDDPVTVVLAQLDRLEALVAGVD
PGARQADAIGTRLDALLNRWRRETRPTTPAGVLSADATADEIFDLIDRELR
selected fasta
>polyketide synthase [FkbC]
ATGGCCGAGAACGACCTGATCGAGGCGCTGCGGACGTCGGTCAAGGACAACGCGCAGCTC
CGCCGGGAGAACACCGCGCTGCGCGCCGCGGCGAACGAGCCGCTCGCCGTCGTCGGCATG
GCCTGCCGACTGCCGGGCGGCGTCACCTCACCGGAAGAGCTGTGGCAGCTCGTCGCGGAC
GGCCGCGACGCGATCGGCGACTTCCCCACCGACCGCGGCTGGGACGTGGCCGCGCTGCAC
GCCGCCGCCGAGTCCGCCACCGGGCGGGCCGGCGCACTCGCGGGCGCCGCCGACTTCGAT
GCCGCGTTCTTCGGCATCAGTCCGCGCGAGGCCACCGCACTCGACCCGCAGCAGCGGATC
CTCCTCGAAATCGCCTGGGAGGCGCTCGAACACGCCGGCATCGTGCCGGACACCCTGCGC
GGCAGCGACACCGGCGTCTTCGTCGGCGGCTTCTACTACGGCTACGGCACGGGCGCGGAC
CTGGGCGGATTCGGCGCCTACAGCACACAGCCCGCGGTGCTCGCCGGACGGCTGTCGTAC
TTCTTCGGCATGGAGGGTCCGGCGGTCACGGTCGACACGGCGTGTTCGTCGTCGCTGGTC
GCGCTGCACCAGGCCGGGCAGGCGCTGCGGACCGGGGAGTGCTCGCTGGCGCTGGTCGGT
GGTGTCACAGTGATGGCATCACCACAGACCTTCGTGGAGTTCTCCCGGCAGGGCGGCGTC
GCGCCGGACGGACGGTGCAAGGCGTTCGCTGACGCGGCGGACGGCACCGGTTTCGCCGAG
GGGGCCGGCGTCCTCGTCGTCGAAAAGCTCTCCGACGCCGAGCGCAACGGACACACCGTC
CTCGCGGTCGTCCGCTCCTCCGCCGTCAACCAGGACGGCGCCTCCAACGGCATCTCCGCA
CCCAACGGCCCCTCCCAGCAGCGCGTCATCCGCCAGGCCCTCCACAAGGCGGGGCTCGCC
CCCGCCGACGTGGACGTGGTGGAGGCGCACGGGACGGGGACGACGCTGGGCGATCCCATC
GAGGCGCACGCGATTCTGGCGACGTACGGGCAGGAGCGTGAGGTTCCGCTGCTGCTGGGT
TCGTTGAAGTCGAACATCGGTCATGCGCAGGCGGCTGCGGGTGTCGCCGGTGTCATCAAG
ATGGTCATGGCGATGCGGTATGGCATCGCGCCGAAGACGCTGCATGTGGACGAGCCGTCG
TCGCATGTGGACTGGACCGAGGGCGCGGTGGAACTGCTCACCGAGGCGCGGGCGTGGCCC
GACGCGGGACGTCCGCGCCGGGCCGGTGTCTCCGCTTTCGGGGTGAGCGGTACGAACGCG
CACGTGATCCTTGAGGGTGTTCCCGGGCCGTCGCGTGGGGAGTCGGCTGTCGATGGGTTG
GTGCCGTTGCCGGTGTCGGCTCGGAGTGAGGTGAGTCTGCGGGGGCAGGTGGAGCGGCTG
GAGGGGTATCTGCGCGGGGGTGGTGTGGATGTGGCCGCGGTCGCGCAGGGGTTGGTGCGT
GAGCGTGCTGTCTTCGGTCACCGTGCGGTGTTGTTGGGCGATGCCCGGGTGATGGGTGTG
GCGGTGGATCAGCCGCGTACGGTGTTCGTCTTTCCCGGGCAGGGTGCTCAGTGGGTGGGC
ATGGGTGTGGAGTTGATGGCGTGTTCTGCGGTGTTCGCGGCTCGTATGGAGGAGTGTGCG
CGGGCGTTGTTGCCGCACACGGGCTGGGATGTGCGGGAGATGTTGGCGCGGCCGGATGTG
GCGGAGCGGGTGGAGGTGGTCCAGCCGGCCAGCTGGGCGGTCGCGGTGAGCCTGGCCGCG
CTGTGGCAGGCGCATGGGGTCGTGCCGGACGCGGTGGTCGGACACTCCCAGGGCGAGATC
GCGGCGGCGTGTGTGGCCGGAGCCCTCAGCCTTGAGGACGCCGCCCGCGTGGTGGCCTTG
CGCAGCCAGGTGATCGCCGGGCGGCTGGCCGGGCGGGGGGCGATGGCTTCGGTGGCGTTG
CCGGCCGGTGAGGTGGACCTGGTCGAGGGCGTGTGGATCGCGGCGCGTAACGGCCCGTCT
TCGACTGTGGTGGCGGGGGACCCGTCCGCGGTGGAAGAAGTGGTGACGCGGTACGAGGCC
GAAGGCGTGCGAGTGCGCCGTATCGCGGTCGACTACGCCTCCCACACGCCCCACGTGGAA
GCCATCGAGGACGAGTTGGCCGAGGTACTGGAGGGGATTTCCGGCGGGACCGGGTCGGTG
GCCTGGTGGTCCACGGTGGACAGCGCCTGGGTGACCGAGCCGGTGGATGAGGGCTACTGG
TACCGGAACCTGCGTCGCCCCGTCGCGCTGGACGCGGCGGTGGCGGAGCTGGACGGGTCC
GTGTTCGTGGAGTGCAGCGCCCATCCGGTGCTGCTGCCGGCGATGGAACAGGCTCACACG
GTGGCGTCGTTGCGGACCGGTGACGGCGGCTGGGAGCGGTGGCTGACGGCGTTGGCGCAG
GCGTGGACCCTGGGCACGGCAGTGGACTGGGACACGGTGGTCGAACCGGTGCCGGGACGG
CTGCTCGATCTGCCCACCTACGCGTTCGAGCACAGGCGGTACTGGCTGGAGGCGGCCGGT
GCCACCGATCTGTCCGCGGCCGGGCTGACCGGGGCGGCGCATCCGATGCTGGCCGCCGTC
ACAGCACTGCCCGCCGACGACGGTGGTGGTGTTGTTCTCACTGGCCGGATCTCGTTGCGT
ACGCATCCCTGGCTGGCTGATCACGCGGTGCGGGGCACGGTTCTGCTGCCGGGTACGGCG
TTTGTGGAGCTGGTCATCCGGGCCGGTGACGAGACCGGTTGCGGGGTGGTGGATGAACTG
GTCATCGAGACCCCGCTCGTGGTGCCGGTGACCGGCGCGGTGGATGTGTCGGTGACCGTC
GAAGGGGCCGATGAGGCCGGACGGCGGCGAGTGACCGTCCACGCGCGTACCGAGGGCACG
GACAGCTGGACCCGGCACGCCAGCGGCACCCTCGGCCGGGCCGGAAGCGTCGCGGCGGTC
CCGCCGCCCGCGTGGCCGCCGCCGGGCGCGCGACGCGTCGACGTGAGCGCGTTCTACGAG
CGGCTGGCCGAGACCGGCTACAGCTACGGCCCAGCGTTCCAGGGACTGCGCACCGCCTGG
CGCGACGGCGAAACCCTGTACGCCGAGGTGGAGATCGCCGGGGAACAGGCGGACGACACG
CCGCACTATGGCGTCCACCCGGCGCTGTTCGACGCGGCCTTGCACGTCACCTGCCTGCCG
CTGCTCGCGGAACAGGAAGCGGAGGTGCGGCTGCCGTTCTCGTGGAGCGGCGTGCGGTTC
CACACGACCGGGGCCACCACGCTGCGCGTCACGATCACTCAGGGCCCGGACGGCGCTGCC
GTGCATGCGACGGACCCGGTCGGCCAACCGGTGGTGACCGTCGCCGCGCTGACCGCGCGA
CCGGTGAACGTCGACGGCGACGCCGCCGTCGTACGGAACTCCTTGTACGGCCTCTCCTGG
ACCGAGCTGCCCACTCCCGGGCCCGGTCCTGCGGACGCGGTCCACATCGTCTCCGCGCTC
CCGGAACCGGGCGCGGATGTCCTCGACGAGACGTACCGGCTCACCGAGTTCGTGCTCGGC
GAGCTGCACCGGGTGATCGCCGAGGACGGCCCTGCGGAGACCACCCTCGTCGTCCGGATC
GACGCGGGACCGGTCGGAGGAGCGGTCGCCGGCCTCGTCCGGTCCGCCCAGGCCGAGCAC
CCGGGCCGGTTCGTGCTGGTGGAGACCGGCACCGACACCCCCATCGAGGCGCTGGCCGCC
GCCACGACACTGGCCGAGCCGTACGTCCGCGTCACCGACGGCCGGTACGAAGCGCCGCGG
TTCACCCGCACGGCCGCCGCGGAAACGCCCGAACCGCTGCTCGACCCGGACGGCACGGTG
GTCATCACCGGCGGCTCGGGTGTGCTGGCAGGTCTCCTCGCCCGGCATCTCGTCGCCGAG
CATGGCGCCCGCCACCTCCTGTTGCTGTCGCGCAGCGAACCGCCGGCGGACACTCCCGGT
GTCCACATCCGCTGTGACGTCGCCGACCGGGACCAGCTCGCCGCCGCGCTCGCCGCCGCC
GGCAGGCCGCTCACGGCGGTCTTCCACACGGCAGCCGTGCTCGACGACGGCGTGACCACG
GCACTCACCCCGGAGCGGCTCGCCACCACACTGCGCCCCAAAGCCGACGGCGCCTGGCAC
CTGCACGAGCTGACCCGGGACGCGGACCTGCGCTCGTTCGTCCTCTACTCGTCCGTCGCG
GGCATCATGGGCGGCCGCGGCCAGGGCAACTACTCGGCGGCGAACGGGTTCCTCGACGGA
CTCGCGACGCTGCGCCATGCCGAAGGACTGCCCGCGCTGTCGCTGGCCTGGGGCCTCTGG
GCCGATGACAGCGGACTCACCGGCAGCATGAGCGGCACCAACCGCACCCGTGTCCGCCGC
GGCGGTTTCCGCCCCATGTCGGCCGGTGTGGGCATGCGCCTGCTGGAAGCCGCGGCCGGA
ACCGGCACCGCGTTCGCCGTGGCGGCCACGATGGACCTCACCGCGCACACATCGCCGCTT
TTCGCCGATCTGCGCCGCGCCGTATCGCGCCCGGCGGCGGCCACCGCCGTTCCGCTCGCC
GACCGGCTCGGCACCATGTCCGGCGCTGAGCGGGACACCGCGCTGCTGGCACTGGTCCGC
GACAACGCGGCGGCGGTGCTCGGCCACGCGGACGCCGCGGACGTGTCCGCGGACGCGGCC
TTCAAGGAACTGGGTATCGACTCGCTGACCGCCGTCGAACTGCGGAACCGACTCGCCGCG
GCGACCGGTGTCCGACTGCCCGCCACGCTTGTCTTCGACTACCCGACGCCGCGGGCCATC
GCGTCGCGGTTGGACGAGGCTCTGGTCGGTGGTGCCGCACCGGTCGCTGTTCCCACAGCC
GCCGCGACCCGTGACGAACCGCTGGCCATCGTGGGCATGGCCTGCCGACTGCCGGGCGGC
GTCACCTCGCCCGACGACCTGTGGCGCATGGTGGACAGTGGCGGCGACGCGGTCACCGGC
TTCCCGGCCGACCGTGGCTGGGACCCGTCCGGCCTCACCGGCGGATCGGACACGGACCGC
GGCGGCTTCCTCTCCGACGCCGCCGGCTTCGATGCCGCGTTCTTCGGCATCAGCCCCCGT
GAGGCACGGGCCATGGACCCCCAGCAGCGGATCCTGCTGGAAACGACATGGGAGGCGTTC
GAGAGCGCGGGCATCGTGCCGGGCACACTGCGCGGCAGCGACACCGGCGTGTTCATGGGC
GCCTTCTCGTACGGGTACGGCGTCGGCGCGGACCTGGACGGGTTCGGCTCGATCGGCATG
CAGCCCAGCGTGCTCACCGGCCGGATCTCGTACTTCTATGGGCTCCAGGGACCGGCGTTC
ACGGTGGACACGGCGTGCTCGTCGTCGCTGGTCGCGCTGCACCAGGCCGGGCACGCACTG
CGCCACGGGGAGTGCTCGCTGGCGCTGGTCGGCGGTGTCACCGTCATGGCGACCCCGACC
GGGTTCGTGGAATTCCAGCAGCAGGGCGGACTCTCCCCCGACGGCCGCTGCCGCGCGTTC
GCGGACGCCGCCAACGGCACCGGCTGGGCGGAGGGCGCCGGCGTTCTTGTGCTGGAGCGG
CTCTCCGACGCCGAGCGCAACGGACACACCGTTCTCGCGGTCGTCCGCGGGTCGGCGGTG
AACCAGGACGGTGCCTCCAACGGGCTGTCCGCCCCCAACGGCCCGTCCCAGCAGCGTGTC
ATCCAGCAGGCGTTGGTGAACGCCGGACTGCGCGCCGCCGATGTGGACGTGGTGGAGGCG
CACGGGACGGGGACGACGCTGGGCGATCCCATCGAGGCGCAGGCCATTCTGGCGACGTAC
GGGCAGGAGCGTGAGGTTCCGCTGCTGCTGGGTTCGTTGAAGTCGAACATCGGTCATGCG
CAGGCGGCGGCGGGTGTCGCCGGTGTGATCAAGATGGTCATGGCGATGCGGTACGGGATC
GCGCCGAAGACGCTGCATGTGGACGAGCCGTCGTCGCATGTGGACTGGTCGGCCGGTGCG
GTGGAGCTGCTCACCGAGGCGAGGCCGTGGCCCGAGTCGGATCGGGCACCGCATGCGGGT
GTGTCGTCGTTCGGGGTGAGCGGTACGAACGCGCACGTGATCCTTGAGGGTGTTCCTGGG
CCGTCGCGTGGGGAGTCGGTTGTTGACGGGTTGGTGCCGTTGCCGGTGTCGGCTCGTGGT
GAGGTGAGTCTGCGGGGGCAGGTGGAGCGGCTGGAGGGGTATCTGCGCGGGGGTGGTGTG
GATGTGGCCGCGGTCGCGCAGGGGTTGGTGCGGGAGCGTGCTGTCTTCGGTCACCGTGCG
GTGCTGCTGGGCGATGCCCGGGTGACGGGTGTGGCGGTGGACCAGCCGCGTACGGTGTTC
GTCTTCCCCGGCCAGGGCGCCCAGTGGGTCGGCATGGGCGTGGAACTCATGGCCCACTCC
GCGGTGTTCGCCGCGCGTATGGAGGAGTGCGCTCAGGCGTTGCTGCCGCACACGGGCTGG
GATGTGCGGGAGATGTTGGCGCGGCCGGATGTGGCGGAGCGGGTGGAGGTGGTCCAGCCG
GCCAGCTGGGCGGTCGCGGTGAGCCTGGCCGCGCTGTGGCAGGCGCATGGGGTCGTGCCG
GACGCGGTGATCGGACACTCCCAGGGCGAGATCGCGGCGGCGTGCGTGGCCGGAGCCCTC
AGCCTCGAGGACGCCGCCCGCGTGGTGGCATTGCGCAGTCAGGTCATCGCGGCGCGACTG
GCCGGGCGGGGAGCGATGGCTTCGGTGGCGTTGCCGGCCGGTGAGGTCGGTCTGGTCGAG
GGTGTGTGGATCGCGGCGCGTAACGGCCCGGCTTCGACGGTGGTGGCGGGGGACCCGTCG
GCGGTGGAGGAGGTGGTGGCGCGGTATGAGGCCGAAGGCGTGCGGGTGCGTCGTATCGCG
GTCGACTACGCCTCCCACACGCCCCACGTGGAAGCCATCGAGGATGAACTGGCCAAGGTA
CTGGAGGGGGTGGCAGGGAAGGCCGCGTCGGTGGCGTGGTGGTCGACCGTGGACAGCGCC
TGGGTGACGGAGCCGGTGGATGAGGGGTACTGGTACCGGAATCTGCGTCGTCCGGTGGCG
TTGGACGCGGCGGTGGCGGAGCTGGATGGGTCGGTGTTCGTGGAGTGCAGTGCCCATCCG
GTGCTGCTGCCGGCGATGGAGCAGGCTCACACGGTGGCGTCGTTGCGGACCGGTGACGGC
GGCTGGGAGCGGTGGCTGACGGCGTTGGCGCAGGCGTGGACCCTGGGCACGGCAGTGGAC
TGGGACACGGTGGTCGAACCGGTGCCGGGACGGCTGCTGGATCTGCCCACGTACGCGTTC
GAGCACAGGCGGTACTGGCTGGAGGCGGCCGGTGCCACCGATCTGTCGGCGGCGGGGTTG
ACGGGTGCGGCGCATCCGATGCTGGCCGCTGTCACAGCGCTGCCCGCCGACGATGGTGGT
GTTGTTCTCACTGGCCGGATCTCATTGCGCACTCACCCCTGGCTGGCTGATCACGCGGTG
CGGGGCACGGTCCTGCTGCCGGGTACGGCGTTTGTGGAGCTGGTCATCCGGGCCGGTGAC
GAGACCGGTTGCGGGATAGTGGACGAGCTGGTCATCGAATCCCCCCTTGTGGTGCCGGTG
ACCGCAGCGGTGGATGTGTCGGTGACCGTGGAAGGGGCTGATGAGGCCGGACGGCGGCCG
GTGACCGTCCACGCGCGTACCGAGGGCACGGGCAGCTGGACCCGGCACGCCAGCGGCACC
CTGACCCCCGACACCCCCGACACCCCCGGTGTTGTCGGTGTGGAGCCGTTCTCGCAGTGG
CCGCCGGTCACGGCCGTGGCCGTCGACGTCTCGGGGTTCTATGACGAACTGCGGGATGCC
GGTTATGAGTACGGGTCGGCGTTCCAGGGGTTGCGGGCTGCCTGGCGTGATGGTGACACC
GTGTATGCCGAGGTGGCGCTGCCCGACGAGCAGGCCGCCGAGGCGGACGGTTTCGGTGTG
CATCCGGCGCTGCTCGACGCGGCCCTGCACGCCGTCGCCCTCACCACGCCGGACGACAGC
GCTGCGGGTCTGCCGTTCGCCTGGAAGGGGGCCCGGTTCGTCGCCACGGGCTCGGCCATG
CTCCGAGCCGTGATCACTCGTGACGGCGACGAGCTGAGTCTGCGCGTCGCCGACTCCGCC
GGCCAACTCGTCGCCGAGATCCGGACGGTCCGCACCCGCCCGCTGTCCCCACCCGTCGGC
ACCGGCCTGATGCGTCTCACCTGGATCGAGGTCGCCGCACCCACGGATGTCCCCGCGACC
GACGTGGACGTCATCACGTTGCCTGCCGCTGATGGCGACGACCCGGTGGCCGAGACGCGT
GCGCTCACCACCCGGCTGCTGACCGCCCTGACCGGCTCCGGCGGGGATCTGCTCGTGCAC
ACCACCGCGGGCCTCGCCACCGGCGCGGCGGCCGGACTGCTGCGCGCCGCCCAGGCCGAG
CAGCCCGGCCGGTTCGTCCACGTCGAGACCGAGTCCGGCGTCACGCTCGCCCCCGAGCAG
CAGCGCATCGCCGTCGCACTCGGCGAGCCGCGTCTGCGGCTGCGCGGCGGCCGGTTCGAG
GCGGCCCGCCTCACCCGGGTGCCGGAGCCGCTCACCGTGCCGGACAGCGACACGTGGCTG
ATCCGGCCGGCGCGGACGGGCACCCTCGACGGCCTCACCGCGGCCGACTCGGCGGAGCCC
CGGCGCCCCCTCGCCCCGGCCGAGGTCCGGATCGGTGTGCGTGCGGCGGGCCTCAACTTC
CGCGATGTGCTGATCGCGCTCGGCACCTACCCCGGTCAGGGCGTGCTCGGCGGCGAGGCC
GCGGGCATCGTCCTGGAGACCGGCGCCGACGTCTCCGGTCTGGCACCGGGCGACCGCGTC
TTCGGCCTCGTCGGCACCGGCTTCGGCCCCACGGTCATCGCCGACCACCGGATGCTCGGC
CGGATGCCGGACGGCTGGACGTTCCCGCAGGCGGCGTCCGTGATGACCGCGTTCGCGACC
GCGTGGTACGGCCTGGTCGACCTCGCCGGGCTGCGCCCCGGCGAGAAGGTCCTGATCCAC
GCGGCCACCGGCGGTGTCGGTTCCGCCGCCCGGCAGATCGCGCGGCACCTGGGCGCGGAG
GTGTACGCGACCACCAGCGCCGCGAAGCGCCATCTGGTGGACCTGGACGGAGCGCATCTG
GCCGATTCCCGCAGCACCGCGTTCGCCGACGCGTTCCCGCCGGTCGACGTCGTGCTCAAC
TCGCTCACCGGTGAACTCCTCGACGCGTCCGTCGGCCTGCTCGCGCCGGGTGGCCGGTTC
ATCGAGATGGGGAAGACGGACATCCGGCACGCCGTCCAGCGACCGTTCGACCTGATGGAC
GCGGGGCCCGACCGGCTCAAGGAGATCATCGCGGAGCTGCTCGGCCTGTTCGCGCGCGGT
GTGCTGCACCCGCTGCCGGTGACGGTGCACGACATGCGGCAGGTCCGCGAGGCGCTGGCG
ACCATGAGCCGCGGCGAGCACACCGGCAAGATCGTCCTCACGGTCCCGCGGCCGCTGGAC
CCCGAGGGGGCCGTCGTCATCACCGGCGGCTCCGGCACCCTCGCCGGCATCCTCGCCCGC
CACCTGAACCACCCCCACACCTACCTCCTCTCCCGCACCCCACCCCCCGACACCACCCCC
GGCACCCACCTCCCCTGCGACGTCGGCGACCCCCACCAACTCGCCACCACCCTCGCCCAC
ATCCCTCAACCCCTCACCGCCGTCTTCCACACCGCCGGAACCCTCGACGACGCCCTGCTC
GACAACCTCACCCCCGACCGCATCGACACCGTCCTCAAACCCAAGGCCGACGCCGCCTGG
CACCTGCACCGGCTCACCCGCGACACCGACCTCGCCGCATTCGTCGTCTACTCGTCGGCG
GCCGGTGTGCTGGGCACCCCCGGTCAGGGCAACTACGCGGCGGCGAACGCGTTCCTCGAC
GCGCTCGCCGAACACCGGCGTGCACAAGGGCTGCCAGGGCTGTCGATCGCGTGGGGGCTG
TGGGACCAGGCGAGTGGCCTGACCGCGGACCTGACCGACGCCGACCGGCGCCGTATGCGC
AAGGGTGGGGCGAGCGCGCTCACCGCCGAACAGGGCATGCGCATGTACGACGCCGCCGTC
CACACCGGAACGGGCAGTGTCGTCGCCGTGGCGGGCGACCTGCCGCCGGACCTCCCGCTG
CTGCGTGGCCGGCCCAAGCCGTCGGCCCGCCGGAGCGCCCGCAACGAGCAGGAACGCCCC
ACCGACCTGCTCGCCCTCGTCCGGCAGAAGGCAGCGGCCGTCCTGGGCCACGCCGACCCG
GAGGACATCCCGGAGGACGCGGCGTTCCGGGAACTCGGTGTGGACTCGCTCATCGCGGTG
CAGCTGCGCAACGGCCTCAACGAGGCGACCGGTCTGCGACTGTCCGCCACGCTCGTCTTC
GACTACCCGTCGCCGCGCGCACTCGCCGACCGCATCGGTGAACTGCTGTCCCCGGACGAC
CCGGTGACCGTGGTGCTCGCGCAGCTCGACCGGCTGGAAGCACTCGTTGCCGGTGTCGAC
CCGGGCGCCCGCCAGGCGGACGCGATCGGAACCCGGCTGGACGCCCTGCTCAACCGCTGG
CGGCGGGAGACCCGCCCGACCACGCCGGCCGGCGTGCTGTCCGCGGACGCGACCGCGGAC
GAGATTTTCGACCTCATCGACAGGGAGCTGCGATGA
[5] KS33..397
[5] AT528..800
[5] methylmalonyl-CoA712..715
[5] DH874..1036
[5] KR1298..1463
[5] ACP1555..1625
[6] KS1646..2008
[6] AT2139..2411
[6] methylmalonyl-CoA2323..2326
[6] DH2485..2651
[6] ER2907..3193
[6] KR3203..3364
[6] ACP3443..3513
[5] KS97..1191
[5] AT1582..2400
[5] methylmalonyl-CoA2134..2145
[5] DH2620..3108
[5] KR3892..4389
[5] ACP4663..4875
[6] KS4936..6024
[6] AT6415..7233
[6] methylmalonyl-CoA6967..6978
[6] DH7453..7953
[6] ER8719..9579
[6] KR9607..10092
[6] ACP10327..10539

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [521-648]  6.90000000000007e-127 G3DSA:3.40.366.10 [712-817]  6.90000000000007e-127 G3DSA:3.40.366.10 [2131-2259]  6.90000000000007e-127 G3DSA:3.40.366.10 [2323-2428]  6.90000000000007e-127 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1298-1450]  9.40000000000003e-49 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1583-1598]  PS00012 [3471-3486]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1554-1628]  1.29999999999998e-45 G3DSA:1.10.1200.10 [3442-3516]  1.29999999999998e-45 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1559-1623]  5.69999999999999e-14 PF00550 [3447-3512]  1.9e-13 PF00550
PF00550   PP-binding
 [1555-1625]  PS50075 [3443-3513]  PS50075
PS50075   ACP_DOMAIN
 [1548-1662]  7.60000011115812e-32 SSF47336 [3436-3550]  7.19999557654549e-23 SSF47336
SSF47336   ACP_like
IPR011032 GroES-like (Domain)
 [2901-3052]  7.30000590915208e-29 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [2927-2981]  5.10000000000001e-06 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [3203-3363]  1.09999999999999e-46 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [33-273]  7.59999999999998e-86 PF00109 [1646-1884]  1.60000000000002e-85 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [281-397]  1.5e-46 PF02801 [1892-2008]  3.89999999999997e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [528-800]  9.2000000000001e-85 PF00698 [2139-2411]  8.19999999999987e-84 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [526-799]  1.70000295590053e-52 SSF52151 [2137-2410]  8.59998776239544e-53 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [651-711]  4.50000034739347e-16 SSF55048 [2262-2322]  1.29999924468179e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [32-284]  G3DSA:3.40.47.10 [287-448]  3.90000000000001e-123 G3DSA:3.40.47.10 [1649-1896]  G3DSA:3.40.47.10 [1897-2059]  3.90000000000001e-123 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [25-386]  2.99998750445706e-93 SSF53901 [1638-1997]  5.39997012872478e-95 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1297-1465]  6.19999999999994e-56 G3DSA:3.40.50.720 [3042-3139]  3.90000000000001e-14 G3DSA:3.40.50.720 [3203-3391]  6.19999999999994e-56 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [186-202]  PS00606 [1797-1813]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [530-808]  3.10001307370203e-94 SM00827 [2141-2419]  3.19999899046355e-94 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1556-1628]  3.59998852907783e-33 SM00823 [3444-3516]  9.49996855930963e-34 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [874-1036]  3.60002015031011e-81 SM00826 [2485-2651]  8.50003024809048e-76 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [35-449]  SM00825 [1648-2060]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1298-1463]  1.49999648196323e-49 SM00822 [3203-3364]  4.50001022902825e-45 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [2907-3193]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit