close all open/close all

CDS information : Asco_00140


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction46,571 / 23,994 / - [in whole cluster]
46,571 / 23,994 / - [in contig]
Locationcomplement(23994..46571) [in whole cluster]
complement(23994..46571) [in contig]
TypeCDS
Length22,578 bp (7,525 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)FkbB
Gene
Gene (GenBank)fkbB
EC number
Keyword
Note
Note (GenBank)
  • PKS loading module through module 4
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
Related Reference
PmId
[11241621] Origin and True Nature of the Starter Unit for the Rapamycin Polyketide Synthase We thank Dr. Bradley S. Moore for help with the deuterium NMR experiments. This work was supported by grants from The Wellcome Trust (to J.S. and P.F.L.) and from the NIH (AI20264 to H.G.F.). (Angew Chem Int Ed Engl. , 2001)

close this sectionPKS/NRPS Module

0
1 methylmalonyl-CoA
2 methylmalonyl-CoA
3 malonyl-CoA
4 ethylmalonyl-CoA
A35..435
ER627..918
PCP1074..1144
KS1161..1529
AT1660..1930
DH2006..2172
KR2427..2588
ACP2665..2735
KS2760..3129
AT3274..3583
dh3618..3772
KR4036..4205
ACP4287..4357
KS4379..4748
AT4880..5119
dh5203..5365
KR5616..5786
ACP5868..5942
KS5964..6333
AT6476..6780
dh6826..6986
ACP7400..7470

close this sectionSequence

selected fasta
>polyketide synthase [FkbB]
MARVEPIRPLHELLRIHAERRGDRIAYTDSQRAVTYTQLRLRAGRLAGHLAASGVDRGDR
VAMLLGNRIETIEVYLAAARAAAVAVPLNPDAADAELAHFLTDSGATVLVTDETHLDQVR
RTGTDATVVLVGRRAPDCVSYEDLAGTEPPCPPRDDLGLDEPAWMLYTSGTTGRPKGVVS
AQRSGLWSAMHCDVPSWRLTEDDELLWPAPLFHSLGHHLCLLAVLTVGASARILGGFVAR
DVLDALAEHSSTVLVGVPTMYRYLLGAVSGEPRARALRVALVAGSTSPASLTRDFEATFG
VPLLDTYGCTETTGSLTANTLEDARVPGSCGLPVPGLSLRFVDPVSGADVAPGEEGELWA
SGPSLMLGYHAQPEATAQVLVDGWYRTGDLARQAETGHVTITGRVKELIIRGGENIHPRE
IETVAQEVAGVRDAAAAGRPHPVLGDIPVLYVVSDGPRVPAEAILAECRRRLAYFKVPDE
IWHVTTIPRTASGKVQRARLAGLPAHLVATGSGEATLCELVWERRDLPGTPSPRRTVVTR
RAVGVGPAEIPDADQARLWDEALRRQAAEPGSFVLVDTDGDDDLVPAAASLGEPQIALRA
GVAYVPRLVRADTTPLPTAPVGAAPARLRNAPRPRRRPARRPAAPLAAGEVRIDVRAAGL
NFRDVLIALGTYPGEGEMGGEAAGIVTEVGPGVDDLAPGDRVFGLVQDAFRRSVVADRRL
VARIPRGWSFPIAASVPIVFATAWYGLVDAGELRPGQKVLVHAATGGVGMAATRIARHLG
AEVYATASPAKQHLLHADGFDTDHVANSRSAAFADTFPPVDVVLNSLTGELLDASIGLLA
PGGRFVEMGKTDIRHAAQQPFDLADVDPARLREILELLLDLFDRGELCPLPVQPWDIRRA
RDAFAWMSHARHTGKMVLTVPPPIGPDAPVLVTGEDADTVAGLLRDETGLTHVTTAAEEA
ANPGALVHVLLDGPAGADAHTRPRAAEGLPTVTVRALPGIERPALTGDLIEKAIAGGGSY
IVARTGSAGARAATMAGATPPILTALTGPAEPDATEQEWANRLAAARAGREDVLLDLVRD
SVATVLGLPGAGHCSPDRTFRENGLDSLTTVEFTNTVAARTGLRVPASTAFDHPTPRAFA
AHLAGSATAAPATAQTLGSGDPVAIVGMACRLPGGVASPEDLWRLVAAGTEAITEFPTDR
GWDVDALYDPDPDAAGRSTTRHGGFLAGAGFDAAFFGISPNEALAMDPQQRLILETSWEA
FENAGIVPDRLRESDTGVFMGAFNQGYGVGRDLGGLGVTATQTSVLSGRLSYVYGLQGPA
VTVDTACSSSLVALHQAAQALRAGECSLALVGGVTVMANTAELVEFSRQRGLSPDGRCKA
FADAADGTGFAEGVGVLVLERLSDAERNGHTVLAVVRGSAVNQDGASNGLSAPNGVAQQR
VIRQALVNAGLRAADVDVVEAHGTGTRLGDPIEAQAVLAAYGQDRDTPLYLGSVKSNIGH
AQAAAGVAGVIKMVMAMRHGIAPKTLHVDEPSSHVDWSAGAVELLTEARPWPESDRAPHA
GVSSFGVSGTNAHVILEGVPGPSRVESGGDGLVPLPVSARGEVSLRGQVERLEGYLRGGG
VDVAAVAQGLVRERAVFGHRAVLLGDARVMGVAVDQPRTVFVFPGQGAQWVGMGVELMDR
SAVFAARMEECARALLPHTGWDVREMLSRSDVAERVEVVQPASWAVAVSLAALWQAHGVV
PDAVVGHSQGEIAAACVAGALSLEDAARVVALRSRVIAARLAGRGAMASVALPAGEVGLV
EGVWIAARNGPASTVVAGDPSAVEEVVARYEADGVRVRRIAVDYASHTPHVEAIEDELAE
VLKGISGGTGSVAWWSTVDSAWVTEPVDEGYWYRNLRRPVALDAAVAELDGSVFVECSAH
PVLLPAMEQARTVASLRTGDGGWERWLGALAQAWTLGAGVDWGTVVEPVPGRLLDLPTYA
FEHRRYWLEAAGATDLSAAGLTGAAHPMLAAVTALPADDGGGVVLTGRISLRTHPWLADH
AVRGTVLLPGTAFVELVIRAGDETGCGVVDELVIESPLVVPVTAAVDVSVTVEGADEAGR
RPVTVHARTEGTGSWTRHASGTLTPDTPDTSNASGEPFSQWPPATAAAVDVSGFYDELRD
AGYEYGSAFQGLRAAWRDGDTVYAEVALPDEQAAEADGFGVHPALLDAALHAGRLDAGGG
IELPFSWTGVRLNATGAAAVRVALTRGEAGVAVRVADPDGRPVVSVDSLVLRERADTPSG
PNPLRLEWLAVAEAVYDGDLPEGHVLITAAHPDDPEDIPTRAHTRATRVLTALQHHLTTT
DHTLIVHTTTDPAGATVTGLTRTAQNEHPHRIRLIETDHPHTPLPLAQLATLDHPHLRLT
HHTLHRPHLTPLHTTTPPTTTPLNPEHAIIITGGSGTLAGILARHLNHPHTYLLSRTPPP
DTTPGTHLPCDVGDPHQLATTLAHIPQPLTAVFHTAATLDDGILDALTPDRLTTVLHPKA
NAAWHLHHLTQNQPLTHFVLYSSAAAVLGSPGQGNYAAANAFLDALATHRHTLGQPATSI
AWGMWHTTSTLTGQLDDADRQRVRDGFRPLTEAEGTHFIDASLAADVPFMVAAIPTEPVR
QRTERRIAARAEDNRDRDRDRDRDLLAIVCAATAAVLGHADASEITPTTAFKDLGIDSLS
GVRLRNSLAETTGVRLSATAVFDHPTPAALAARLDEERRGEPAPAAPAATVPAPTVAGNE
PLAIVAMACRMPGGVRSPEDLWRLVDSGGDAITEFPADRGWDLAALYDPNPDAVGKVSVR
HGGFLTGAADFDAAFFGISPREALAMDPQQRLVLEASWEAFERAGILPESVRGSDTGVFM
GAFTQGYGAGVDLGGFGATGTPTSVLSGRLSYYFGLEGPSVTVDTACSSSLVALHQAARS
LRSGECSLALVGGVTVMATTTGFVEFSRQRGLAPDGRAKAFADTADGTSFAEGAGVLVLE
RLSDATRHGHPVLALVRGSAVNSDGASNGLSAPNGPAQQRVIQRALADAGLAPGDVDAVE
AHGTGTRLGDPVEAQALQVAYGRERVHPLLIGSLKSNIGHTQAAAGVAGVIKMVMAMRHG
VLPRTLHVDEPSRHVDWDGDIRLLHRSEPWPVTGRARRAGVSSFGISGTNAHVVLEAGPP
AAPAPVSAPEAEPVPEDVVWPMSARTPEGLRDVAGQLAPLTGAAAAVGHSLATTRTAMRH
RAVVPAREAEAFARGAEVPGAVTGTADVTDTRVVFAFPGQGSQWAGMGAELLATEPVFAR
RLRECATALAPHTGWDLLDVIAQRPGAPAFDRVDVVQPASFAVMVALAELWRAHGVAPAA
VVGHSQGEVAAACVAGVLTLDDAAKVVAVRSRLVATELAGQGGMVSVPPADFDAAVWAGR
LEVAAVNGPASIVVAGAADAVEELLAATPRARRIAVDYASHTAHVETIRGALLDALAGIT
PRTPDVPFFSTVDEAWLDRPADAAYWYDNLRRTVRFAAATGHLADRGYRAFVEVSAHPVL
TTALEDTLAGHAHTVVTGTLRRGEGGLDRFTRSLAALWVRGVPVTWSFATRRVVPLPTYP
FRRDRYWIDAEPAGTSGHPLLGSWVDLARRRGRAGHRGVSVRRQPWLADHEVDGRVIVPG
SALVELLAEAGARLGTPEIAELTIVAPVVVDGDGDTEIQATVGTEVSGRRSVSLHSRTGT
GPWALSATGALSVDTGGPAEPVDWPPADADPADLTGFYDALPLSYGPAFRAMTAMWTGEG
RAYASVRLAEQLTDARYGLHPVLLDAALHALGTVFTDPERRRLAFSWSGVRIHARAATAL
RVLLERVGPDMVRIVATDEHGSPVLDVDSLTVRAADPDAEALFEIAWVPVPASPVPDWTY
LADVPDGEHPPVVVLAVEPGDPGTSPGARTRELGRDLLTTVQTWLAEPRWARSRLIVATR
TGDPAQEALGGLVRTAETEHPGRVALIEADEITPAAIAAGLAAGDEPHVRVADGTARAAR
LRRVAAATGTSPLTGGTVLVTGGTGGLGRLLVDHLLTVHEAAEVVVVSRNGRPGDTPEDD
RVRYVAADVVDRDELAAVVADVAQRLRAVVHMAGIVDDAAVTTMRPEQWDAVLRVKADVA
WHLHELTRDLDLAAFVLYSSISATFGGAGQANYATGNAFLDALARHRHHQGLPAVSLAWG
LWDAADGMGGRLTATDLARIARNGMTPMTAAQGLALFDAALHTDRPALVPIRLDLAAVAA
SDRVPPVLRTLVPAVRRTSAPPAARDMLDLVRTSAAAVLGHRDAHAIAPARAFREVGFDS
LTGVELRNRLADATGLTLPATLVFDHPTAQALAAHLDELAGARATTRRRTPTAAVRQDEP
LAIVGMACRLPGGVASPEDLWRLLESGGDGITAFPTDRGWDVDGLYDPDPDHPGTSTVRH
GGFLAGVADFDAAFFGISPREALAMDPQQRLVLETSWEALEHAGILPESLRGSDTGVFMG
GYFYGYGTGADRGGFGATSTQTSVLSGRLSYFYGLEGPAVTVDTACSSSLVALHQAGQSL
RSGECSLAVVGGVTVMASPSGFVDFSQQRGLSPDGRCKAFADAADGTGFAEGSGVLIVER
LSDAERHGHNVLAVVRGSAVNQDGASNGLSAPNGPSQERVIRQALANAGLTPADVDAVEA
HGTGTRLGDPIEAQAVLATYGQHRDTPVLLGSLKSNIGHTQAAAGVAGVIKMVLAMRHGT
LPRTLHVDTPSSHVDWTAGAVELLTDARPWPETDRPRRAGVSSFGVSGTNAHIILESHPR
PAPEPAPAPDTGPLPLLLSARTPQALDAQVHRLRAHLATGEEDERAVAAALLARTAFPHR
AALIGTDTVTGAAEPDRRLVWLFSGQGSQRPGMGDGLAAAYDVFARTRREVLDALDVPAG
LDLHDTGYAQPAVFALQVALGAQLEAWGVRPDAFVGHSIGELAAAYVAGVWSLEDACRLV
SARARLMQALPSGGAMAAVIASERDALPLLRDGVEIAAVNGPASIVLSGDEEAVLDVAAR
LGRFTRLRTSHAFHSARMEPMLEEFRKVAESLTYHEPRIPMAAGAACTTPEYWVRQVRDT
VRFGEQVAAHDGAVLLEIGPDRSLTRLVDGIPMLHADDEPRSALTALARLHTDGVTVDWP
KVIDPAPARASHPPTYPFERVRYWLGTQTAGDAAPAGQTPVAHPALTAAVTLPGTGDLVL
TGRVDAADPLAHSLHGLAVLPAAALLDLAIRAGDEAGCGALDTFTVDTPLTLPRSGALAL
SVTVSAPGADGRRAVTVHTRHAAGEWTEHAHGILAPDPRTAPAVREMPSTWPPATARPVD
PDDIADRLARAGYTDGPALPRPRAVWADDDAVWAEVALADGQLADAGRYGLHPALLGAAL
RLAAEGDHLPYAFDDVRVHATGATAVRVAVTADGVHLADETGGPVATIGAVRRRPLTITG
AVPGLLRPVLAELPELPPTTATTGRLDDPTVPDVVILPAHGGGGAPLDDTRELGAGVLTA
VQRFLTDDRYADAVLAVHTGPGLASAAAAGLVRTAQAEHPGRIVLVDAAPDTAEPLLAAA
TALDEPQVVLRDGQVYARRLAPAVPAGDAPALDPDGTVLVTGGSGTLAGIISRHLVERHG
VRRLLMLSRSGTASDVPGAEVTAIACDVADRDELASVLAGIDPAHPLTAVVHTAAVLDDG
VLTALTPDRLETVLRPKVDAAWHLHELTQDTELAAFVLYSSAAGVLGSPGQGNYAAANAF
LDALAEQRRAAGLPALSVAWGLWEPESGLTVGTGARMRRDGVTALTAEGGLTLFDAALRS
SDPALVAADPAGLGSSPLLRAPRREPRRRAAGATTLADRIARLSAADAEKDVLAVVRQCT
AAVLGHDGAARVEATATFKELGVDSLMAIRLRNAFTEATGVRLPATAVFDFPTPRAVAAK
LTAALSGRTASPTRTTTAAVRQDEPLAIVGMACRLPGGVASPEDLWRLLESGGDGITAFP
TDRGWDVDGLYDPDPDHPGTSTVRHGGFLAGVADFDAAFFGISPREALAMDPQQRLVLET
SWEALEHAGILPESLRGSDTGVFMGAFSDGYGLGTDLGGFGATGTQTSVLSGRLSYFYGL
EGPAVTVDTACSSSLVALHQAGQSLRSGECSLALVGGVTVMASPSGFVEFSQQRGLAPDA
RCKAFADAADGTGFAEGSGVLIVERLSDAERNGHRVLAVVRGSAVNQDGASNGLSAPNGP
SQERVIRQALANAGLTPADVDAVEAHGTGTRLGDPIEAQAVLATYGQGRDTPVLLGSLKS
NIGHTQAAAGVAGVIKMVLAMRHGTLPRTLHVDTPSSHVDWTAGAVELLTDARPWPETDR
PRRAGVSSFGVSGTNAHVLLEAHPAGEPPAEEPSASKPGEPLIATPLTPLPVSARTATAL
DGQVRRLREHLAARPGHDPRAIAAGLLARRTTFPHRAVLLDDDVVTGTALTEPRTVFVFP
GQGPQWRGMGVELMAASPVFAARMRQCADALIPHTGWDPIAMLDDPEVTRRVDVVHPVCW
AVMVSLAAVWEAAGVRPDAVIGHSQGEIAAACVAGALTLEDGARLVALRSALLLRELAGR
GAMGSVALPAADVEADAARIDGVWVAGRNGATTTTVAGRPDAVETLIADYEARGVWVRRI
AVDCPTHTPFVDPLYDELQRIVADTTSRTPEIPWFSTADERWIDAPLDDEYWFRNMRHPV
GFATAVTAAREPGDTVFVEVSAHPVLLPAIDGATVATLRRGGGVHRLLTALAEAHTTGVP
VDWAAVVPATATAHDLPTYAFHHERYWIETAAGTDASGLGLDAVDHPLLAASVALPDSDE
VLLTGRFSLATHPWLAGHSVDGAVLLPGPAFLELAGRGADEAGCDLLDELVVETPLVLPA
TGAVQVRVTVAAPDDTGRRAVRVHARTDGDRTWTRHASGFAGIATTEPATTPGPWPPEHA
EPVDVAAFYQRLDDAGYEFGPEFRGMSAAWSHGDTVCAEVALDGALARDAARYTLHPALL
VTALQAGSIGAAAENAGVRLPFAFTGVRVHTSGATKLRVTFVHGEGEGGARVHLADELGR
PVAQIGSLITRPPATTGPDGDVRLFRRTWTGVRAPAAPGTTARRYTDLGDDATPDVIVVP
VSGPDEVRTALDDPRTAGATLVVSAEAGPVAGAVAALLDTAEPGRLVLVETTDTVTPRRA
AALSRLDEPHLRLADGRLEAPRLVPAAPTTAAASYGDTVLLAGGSEELAGHLGGHGAEVI
RYEPGTVPETPVTAVVHADGTAESAWELHRLTRDLDLTAFVLAVPSGEAAGPLQALADLR
RAQGLPAVAFTAAADRLTDLLDAACATGEAVVVATAPPGPGDPSPLWRPIQRPTRRSATD
GGSLLERLPDLPHKEREQVLLGVVRDTAATLLGHTDAAAVTATTAFKDLGVDSLTALGLR
NRLSEALGIPLPATLVFDYPAAGALTRHLLTLLAPDVNGTPDDNGTPDGGEPPAQAPAST
TTAEPDDELFDDMDADALIAHVLKG
selected fasta
>polyketide synthase [FkbB]
ATGGCGCGTGTGGAACCAATCCGGCCGTTGCACGAATTGCTCCGCATCCATGCCGAGCGA
CGCGGCGACCGGATCGCCTACACGGATTCCCAACGCGCCGTGACGTACACGCAACTCCGG
CTCCGGGCCGGCCGGCTCGCCGGACACCTCGCCGCGTCCGGCGTCGACCGCGGCGACCGG
GTCGCGATGCTGCTCGGCAACCGGATCGAGACCATCGAGGTCTACCTCGCCGCCGCCCGC
GCCGCCGCCGTCGCCGTCCCGCTCAACCCGGACGCCGCCGACGCCGAACTCGCCCACTTC
CTGACGGACTCCGGCGCGACCGTGCTGGTCACCGACGAAACCCACCTCGACCAGGTGCGC
CGCACCGGCACCGACGCCACCGTCGTGCTCGTCGGGCGCCGGGCACCGGACTGCGTCTCC
TACGAGGACCTCGCCGGGACCGAGCCGCCGTGCCCGCCCCGCGACGACCTCGGCCTGGAC
GAACCCGCCTGGATGCTCTACACCTCCGGCACCACCGGCCGTCCCAAGGGCGTGGTTTCC
GCACAGCGCAGCGGCCTGTGGTCCGCGATGCACTGCGACGTGCCGTCCTGGCGGCTGACC
GAGGACGACGAACTGCTCTGGCCCGCCCCGCTGTTCCACAGCCTCGGCCACCACCTCTGC
CTGCTCGCCGTCCTCACGGTCGGCGCGTCCGCCCGTATCCTGGGCGGCTTCGTCGCGCGT
GACGTCCTCGACGCCCTGGCCGAACACTCCAGCACCGTGCTCGTCGGCGTGCCGACGATG
TACCGCTACCTCCTCGGCGCCGTGTCCGGCGAGCCGCGGGCTCGCGCGCTGCGCGTGGCG
CTGGTCGCCGGATCCACCTCGCCGGCGTCGCTCACCAGGGATTTCGAGGCGACGTTCGGC
GTGCCCCTGCTCGACACGTACGGCTGCACCGAGACGACCGGCTCGCTCACCGCCAACACC
CTGGAGGATGCGCGGGTTCCCGGCTCGTGCGGGCTGCCCGTGCCGGGCCTGTCGCTGCGG
TTCGTCGACCCGGTGTCCGGCGCCGACGTGGCACCCGGCGAGGAGGGCGAGCTGTGGGCG
AGCGGGCCGAGCCTCATGCTCGGCTACCACGCCCAGCCGGAGGCGACCGCCCAGGTGCTC
GTGGACGGCTGGTACCGCACCGGGGACCTCGCACGTCAGGCCGAGACCGGACACGTGACG
ATCACCGGCCGGGTCAAGGAGCTGATCATCCGCGGCGGGGAGAACATCCACCCCCGGGAG
ATCGAGACCGTCGCCCAGGAGGTGGCCGGTGTCCGGGACGCCGCCGCGGCGGGCCGCCCG
CACCCCGTCCTCGGCGACATACCCGTGCTCTACGTCGTTTCCGACGGCCCCCGCGTCCCC
GCCGAGGCGATCCTCGCCGAGTGCCGCCGCCGGCTCGCCTACTTCAAGGTGCCCGACGAG
ATCTGGCACGTCACCACGATCCCCCGCACCGCGTCGGGCAAGGTCCAGCGCGCGCGGCTC
GCGGGGCTGCCGGCCCATCTGGTCGCCACCGGCAGTGGCGAGGCCACGCTGTGCGAACTG
GTCTGGGAGCGGCGCGACCTGCCCGGCACCCCGTCACCCCGCCGGACGGTCGTCACCCGC
CGCGCGGTGGGCGTCGGCCCGGCCGAGATCCCGGACGCGGACCAGGCCCGGCTCTGGGAC
GAGGCGCTGCGCCGCCAGGCCGCCGAACCCGGATCGTTCGTGCTGGTGGACACGGACGGC
GATGACGACCTCGTCCCCGCCGCGGCCTCGCTCGGCGAACCCCAGATCGCGCTGCGGGCC
GGCGTGGCCTACGTGCCCCGGCTGGTACGCGCGGACACCACCCCCCTGCCGACCGCGCCA
GTGGGCGCTGCGCCCGCCCGCCTCCGGAACGCTCCGCGACCTCGTCGTCGCCCCGCTCGA
CGTCCCGCCGCGCCCCTGGCCGCCGGCGAGGTCCGCATCGACGTCCGCGCCGCGGGGCTG
AACTTCCGCGACGTGCTGATCGCGCTCGGCACCTACCCGGGCGAGGGCGAGATGGGCGGG
GAGGCCGCGGGCATCGTGACCGAAGTCGGACCCGGCGTCGACGACCTGGCCCCCGGCGAC
CGCGTGTTCGGTCTCGTGCAGGACGCGTTCCGGCGCAGCGTGGTCGCGGACCGGCGGCTG
GTCGCACGGATCCCACGGGGATGGTCGTTCCCCATCGCCGCGTCCGTGCCCATCGTGTTC
GCCACCGCCTGGTACGGCCTCGTCGACGCGGGCGAGCTGCGACCCGGCCAGAAGGTCCTG
GTCCACGCCGCGACGGGCGGTGTCGGCATGGCGGCGACCCGGATCGCCCGCCACCTCGGC
GCCGAGGTGTACGCCACCGCCAGTCCCGCCAAACAACACCTGCTGCACGCCGACGGCTTC
GACACCGACCATGTGGCGAACTCCCGCAGCGCCGCGTTCGCCGACACCTTCCCGCCGGTC
GACGTCGTGCTCAACTCGCTCACCGGTGAACTCCTCGACGCGTCCATCGGCCTGCTCGCA
CCGGGCGGCCGGTTCGTCGAGATGGGCAAGACCGACATCCGCCACGCCGCCCAGCAGCCG
TTCGACCTGGCCGACGTGGATCCCGCGCGCCTGCGGGAGATCCTCGAACTGCTCCTCGAC
CTGTTCGACCGCGGTGAGCTGTGCCCGCTGCCGGTGCAGCCGTGGGACATCCGCCGTGCG
CGGGACGCGTTCGCGTGGATGAGCCACGCCCGGCACACCGGCAAGATGGTCCTCACCGTG
CCGCCTCCGATCGGCCCGGACGCGCCGGTCCTGGTCACCGGGGAGGACGCCGACACCGTC
GCCGGCCTGCTCCGCGACGAGACCGGCCTCACCCACGTGACCACCGCAGCCGAGGAAGCC
GCGAACCCCGGCGCGCTCGTGCACGTCCTGCTCGACGGCCCGGCCGGCGCCGACGCCCAC
ACCCGGCCACGGGCCGCGGAGGGACTCCCCACCGTCACCGTCCGCGCGCTGCCCGGCATC
GAACGGCCGGCGCTCACCGGCGACCTGATCGAGAAGGCCATCGCGGGCGGCGGCTCGTAC
ATCGTGGCCCGGACCGGTTCCGCCGGGGCGCGGGCCGCGACGATGGCGGGCGCCACGCCG
CCGATCCTCACCGCACTGACCGGACCGGCCGAGCCCGACGCCACGGAACAGGAGTGGGCG
AACCGCCTCGCCGCGGCCCGTGCGGGCCGGGAGGACGTACTGCTCGACCTGGTCCGCGAC
AGCGTCGCCACCGTCCTGGGCCTGCCGGGCGCCGGACACTGCTCCCCGGACCGCACGTTC
CGCGAGAACGGCCTCGACTCGCTCACCACCGTCGAGTTCACCAACACCGTCGCCGCGCGG
ACGGGTCTGCGGGTGCCCGCGTCAACCGCGTTCGACCACCCCACTCCGCGTGCGTTCGCC
GCCCACCTCGCCGGCTCCGCGACAGCGGCACCCGCGACCGCCCAGACCCTCGGCTCCGGC
GACCCCGTCGCGATCGTCGGCATGGCGTGCCGACTGCCCGGCGGGGTCGCCTCGCCGGAG
GACCTGTGGCGGCTCGTCGCCGCCGGTACCGAGGCGATCACCGAGTTCCCCACCGACCGG
GGCTGGGACGTCGACGCGCTGTACGACCCGGACCCGGACGCGGCCGGCCGCTCCACGACA
CGCCACGGCGGATTCCTGGCCGGCGCCGGGTTCGACGCCGCGTTCTTCGGCATCAGTCCG
AACGAGGCGCTGGCGATGGACCCCCAGCAGCGCCTGATCCTGGAGACCTCCTGGGAGGCG
TTCGAGAACGCCGGCATCGTGCCGGACAGGCTCCGGGAGAGCGACACCGGCGTGTTCATG
GGCGCGTTCAACCAGGGCTACGGCGTCGGCCGGGACCTGGGCGGGCTCGGTGTCACGGCG
ACGCAGACGAGCGTCCTGTCCGGGCGCCTCTCGTACGTGTACGGACTTCAGGGCCCGGCG
GTCACGGTCGACACGGCGTGCTCGTCGTCGCTGGTCGCCCTGCACCAGGCGGCACAGGCA
CTGCGGGCCGGGGAGTGCTCCCTGGCGCTGGTCGGCGGTGTCACCGTCATGGCGAACACC
GCAGAGCTCGTGGAGTTCTCCCGGCAGCGCGGACTCTCCCCGGACGGACGGTGCAAGGCG
TTCGCCGACGCGGCGGACGGGACCGGCTTCGCCGAGGGCGTCGGCGTTCTCGTGCTGGAG
CGGCTCTCCGACGCCGAGCGCAACGGGCACACCGTTCTCGCGGTCGTCCGCGGCTCGGCG
GTGAACCAGGACGGTGCCTCCAACGGACTGTCCGCCCCCAACGGCGTCGCCCAGCAGCGC
GTGATCCGGCAGGCGTTGGTCAACGCCGGACTGCGCGCCGCCGATGTGGACGTGGTGGAG
GCGCACGGCACCGGCACGCGGCTGGGCGACCCGATCGAGGCGCAGGCCGTCCTCGCGGCC
TACGGGCAGGACCGCGACACGCCGCTCTACCTCGGTTCGGTCAAGTCGAACATCGGTCAT
GCGCAGGCGGCTGCGGGTGTCGCCGGTGTCATCAAGATGGTCATGGCGATGCGGCATGGG
ATCGCGCCGAAGACGCTGCACGTGGACGAGCCGTCGTCGCATGTGGACTGGTCGGCCGGT
GCGGTGGAGCTGCTCACCGAGGCGAGGCCGTGGCCCGAGTCGGATCGGGCACCGCATGCG
GGTGTGTCGTCGTTCGGGGTGAGCGGTACGAACGCGCACGTGATCCTGGAGGGTGTTCCT
GGGCCGTCGCGTGTGGAGTCGGGTGGTGATGGGTTGGTGCCGTTGCCGGTGTCGGCTCGT
GGTGAGGTGAGTCTGCGGGGGCAGGTGGAGCGGCTGGAGGGGTATCTGCGCGGGGGTGGG
GTGGATGTGGCCGCGGTCGCGCAGGGGTTGGTGCGTGAGCGTGCTGTCTTCGGTCACCGT
GCGGTGCTGCTGGGTGATGCCCGGGTGATGGGTGTGGCGGTGGATCAGCCGCGTACGGTG
TTCGTCTTCCCCGGGCAGGGTGCCCAGTGGGTGGGCATGGGCGTGGAACTCATGGACCGT
TCCGCGGTGTTCGCGGCTCGTATGGAGGAGTGTGCGCGGGCGTTGTTGCCGCACACGGGC
TGGGATGTGCGGGAGATGTTGTCGCGGTCGGATGTGGCGGAGCGGGTGGAGGTGGTCCAG
CCGGCCAGCTGGGCGGTCGCGGTGAGCCTGGCCGCGCTGTGGCAGGCGCATGGGGTCGTG
CCGGACGCTGTGGTCGGACACTCGCAGGGGGAGATCGCGGCGGCGTGTGTGGCCGGAGCC
CTCAGCCTGGAGGACGCCGCCCGCGTGGTGGCGTTGCGCAGTCGGGTGATCGCGGCGCGG
CTGGCCGGCCGGGGGGCGATGGCTTCGGTGGCGTTGCCGGCCGGTGAGGTGGGTCTGGTC
GAGGGTGTGTGGATCGCGGCGCGTAATGGTCCGGCTTCGACGGTGGTGGCGGGGGACCCG
TCGGCGGTGGAGGAGGTGGTGGCGCGGTATGAGGCTGATGGGGTGCGGGTGCGTCGTATC
GCGGTCGACTACGCCTCCCACACGCCTCACGTGGAGGCCATCGAGGACGAACTCGCTGAG
GTACTGAAGGGAATTTCCGGCGGGACCGGGTCGGTGGCGTGGTGGTCGACCGTGGACAGC
GCCTGGGTGACCGAGCCGGTGGATGAGGGGTACTGGTACCGGAACCTGCGTCGCCCTGTC
GCGCTGGATGCGGCGGTGGCGGAGCTGGACGGGTCGGTGTTCGTGGAGTGCAGTGCCCAT
CCGGTGCTGCTGCCGGCGATGGAACAGGCCCGCACGGTGGCGTCGTTGCGGACTGGTGAC
GGTGGCTGGGAGCGGTGGCTGGGGGCGTTGGCGCAGGCGTGGACTCTGGGTGCGGGGGTG
GACTGGGGCACGGTGGTCGAACCGGTGCCGGGGCGGCTGCTGGATCTGCCCACCTACGCG
TTCGAGCACAGGCGGTACTGGCTGGAGGCGGCCGGTGCCACCGACCTGTCCGCGGCCGGG
CTGACCGGGGCGGCGCATCCGATGCTGGCCGCCGTCACAGCACTGCCCGCCGACGACGGT
GGTGGTGTTGTTCTCACCGGCCGGATCTCATTGCGTACGCATCCCTGGCTGGCTGATCAC
GCGGTGCGGGGCACGGTTCTGCTGCCGGGTACGGCGTTTGTGGAGCTGGTCATCCGGGCC
GGTGACGAGACCGGTTGCGGGGTGGTGGATGAACTGGTCATCGAATCCCCGCTCGTGGTG
CCGGTGACCGCAGCGGTGGATGTGTCGGTGACCGTGGAAGGGGCCGATGAGGCCGGACGG
CGGCCGGTGACCGTCCACGCGCGTACCGAGGGCACGGGCAGCTGGACCCGGCACGCCAGC
GGCACCCTGACCCCCGACACCCCGGATACCTCCAACGCTTCCGGTGAGCCGTTCTCGCAG
TGGCCGCCGGCCACGGCCGCGGCCGTCGACGTCTCGGGGTTCTATGACGAACTGCGGGAT
GCCGGTTATGAGTACGGGTCGGCGTTCCAGGGGTTGCGGGCTGCCTGGCGTGATGGTGAC
ACCGTGTATGCCGAGGTGGCGCTGCCCGACGAGCAGGCCGCCGAGGCGGACGGTTTCGGT
GTGCATCCGGCACTGCTCGACGCGGCCCTGCACGCCGGGCGCCTCGACGCGGGCGGCGGG
ATCGAGCTGCCGTTCTCCTGGACGGGCGTGCGCCTGAACGCCACCGGGGCCGCCGCGGTG
CGCGTCGCCCTCACCCGGGGGGAGGCCGGCGTCGCCGTGCGCGTGGCCGACCCGGATGGC
CGTCCTGTCGTGTCGGTGGACTCGCTGGTGCTGAGGGAGCGGGCCGACACCCCGTCGGGG
CCGAACCCGCTCCGGTTGGAGTGGCTCGCGGTCGCCGAGGCGGTCTACGACGGTGACCTG
CCCGAGGGACACGTCCTGATCACCGCCGCCCACCCCGACGACCCCGAGGACATACCCACC
CGCGCCCACACCCGCGCCACCCGCGTCCTGACCGCCCTGCAACACCACCTCACCACCACC
GACCACACCCTCATCGTCCACACCACCACCGACCCCGCCGGCGCCACCGTCACCGGCCTC
ACCCGCACCGCCCAGAACGAACACCCCCACCGCATCCGCCTCATCGAAACCGACCACCCC
CACACTCCCCTCCCCCTGGCCCAACTCGCCACCCTCGACCACCCCCACCTCCGCCTCACC
CACCACACCCTCCACCGACCCCACCTCACCCCCCTCCACACCACCACCCCACCCACCACC
ACCCCCCTCAACCCCGAACACGCCATCATCATCACCGGCGGCTCCGGCACCCTCGCCGGC
ATCCTCGCCCGCCACCTGAACCACCCCCACACCTACCTCCTCTCCCGCACCCCACCCCCC
GACACCACCCCCGGCACCCACCTCCCCTGCGACGTCGGCGACCCCCACCAACTCGCCACC
ACCCTCGCCCACATCCCCCAACCCCTCACCGCCGTCTTCCACACCGCCGCCACCCTCGAC
GACGGCATCCTCGACGCCCTCACCCCCGACCGCCTCACCACCGTCCTCCACCCCAAAGCC
AACGCCGCCTGGCACCTGCACCACCTCACCCAAAACCAACCCCTCACCCACTTCGTCCTC
TACTCCAGCGCCGCCGCCGTCCTCGGCAGCCCCGGACAAGGAAACTACGCCGCCGCCAAC
GCCTTCCTCGACGCCCTCGCCACCCACCGCCACACCCTCGGCCAACCCGCCACCTCCATC
GCCTGGGGCATGTGGCACACCACCAGCACCCTCACCGGACAACTTGACGACGCCGACCGG
CAGCGGGTGCGCGACGGGTTCCGGCCGCTCACCGAGGCCGAGGGCACCCACTTCATCGAC
GCGAGCCTCGCCGCGGACGTGCCGTTCATGGTCGCGGCGATTCCCACCGAGCCCGTCCGG
CAGCGGACCGAGCGCCGCATCGCCGCCCGTGCGGAGGACAACCGCGACCGCGACCGCGAC
CGCGATCGTGACCTGCTGGCCATCGTGTGTGCGGCCACGGCCGCCGTGCTCGGCCACGCC
GACGCCTCCGAGATCACGCCCACGACGGCGTTCAAGGACCTCGGCATCGACTCGCTCAGC
GGTGTCCGGTTGCGCAACAGCCTCGCCGAGACGACGGGGGTACGGCTCTCCGCGACGGCC
GTCTTCGACCACCCGACACCGGCCGCGCTCGCCGCCCGCCTGGATGAGGAACGGCGGGGT
GAGCCGGCCCCTGCCGCTCCGGCGGCGACAGTGCCCGCACCGACGGTGGCGGGGAACGAG
CCGCTGGCGATCGTGGCCATGGCGTGCCGGATGCCCGGTGGCGTGCGGTCACCGGAGGAC
CTGTGGCGGCTGGTCGACTCCGGCGGGGACGCGATCACCGAGTTCCCCGCCGACCGCGGC
TGGGACCTCGCCGCGCTCTACGACCCGAACCCCGACGCGGTCGGCAAGGTTTCCGTGCGT
CACGGCGGCTTCCTCACCGGCGCCGCCGACTTCGACGCCGCGTTCTTCGGGATCAGCCCG
CGTGAGGCGCTGGCGATGGACCCGCAGCAGCGTCTGGTCCTCGAAGCGTCGTGGGAGGCG
TTCGAACGAGCGGGCATCCTGCCCGAAAGCGTCCGCGGCAGCGACACCGGCGTATTCATG
GGCGCGTTCACCCAGGGCTACGGCGCGGGCGTGGACCTGGGCGGTTTCGGGGCGACCGGC
ACGCCGACCAGCGTTCTCTCCGGGCGGCTCTCGTACTACTTCGGTCTGGAGGGCCCGTCG
GTCACCGTCGACACGGCGTGTTCGTCGTCGCTGGTGGCGCTGCACCAGGCCGCGCGGTCG
CTGCGCTCGGGGGAGTGCTCGCTCGCCCTGGTCGGCGGTGTCACGGTGATGGCGACGACG
ACCGGGTTCGTCGAGTTCTCCCGGCAGCGCGGGCTCGCCCCCGACGGCCGTGCCAAGGCC
TTCGCGGACACCGCGGACGGCACGAGCTTCGCCGAGGGCGCCGGTGTCCTGGTGCTGGAG
CGGCTCTCCGACGCCACCCGCCACGGCCACCCCGTGCTGGCGCTGGTGCGCGGCTCCGCG
GTCAACTCCGACGGCGCGTCGAACGGGCTGTCCGCCCCGAACGGGCCTGCGCAGCAGCGC
GTCATCCAGCGTGCGCTCGCCGACGCCGGCCTGGCGCCGGGTGACGTCGACGCCGTGGAG
GCACACGGCACCGGCACCCGTCTCGGCGACCCCGTCGAGGCCCAGGCCCTGCAAGTGGCC
TACGGGCGCGAACGCGTGCATCCGCTGCTGATCGGCTCGCTCAAGTCGAACATCGGCCAC
ACCCAGGCCGCGGCCGGCGTCGCCGGCGTCATCAAGATGGTCATGGCGATGCGGCACGGC
GTCCTGCCGCGCACGCTGCACGTCGACGAGCCGTCCCGGCACGTCGACTGGGACGGCGAC
ATCCGGCTGCTGCACCGCAGTGAGCCGTGGCCGGTCACCGGGCGCGCCCGGCGTGCGGGT
GTCTCGTCGTTCGGCATCAGCGGCACCAACGCCCATGTCGTCCTGGAGGCCGGGCCCCCC
GCCGCGCCCGCACCCGTGTCCGCACCCGAAGCCGAGCCGGTGCCCGAGGACGTGGTCTGG
CCGATGTCGGCCCGGACCCCGGAGGGACTGCGGGACGTCGCGGGACAGCTGGCCCCGCTC
ACTGGCGCCGCGGCCGCGGTCGGCCACTCGCTCGCCACCACCCGGACGGCCATGCGCCAC
CGGGCGGTCGTGCCGGCCCGAGAGGCGGAGGCGTTCGCCCGTGGTGCCGAAGTGCCGGGG
GCCGTGACGGGAACCGCCGACGTCACCGACACACGTGTCGTGTTCGCGTTCCCCGGGCAG
GGCTCCCAGTGGGCCGGCATGGGTGCCGAACTGCTCGCCACCGAGCCCGTGTTCGCCCGG
CGGCTCCGCGAGTGCGCCACGGCGCTCGCCCCGCACACCGGATGGGACCTGCTGGACGTC
ATCGCCCAGCGGCCCGGAGCGCCCGCGTTCGACCGGGTCGATGTCGTGCAGCCCGCGTCG
TTCGCGGTGATGGTGGCGCTGGCGGAGCTGTGGCGTGCGCACGGGGTCGCCCCGGCCGCG
GTCGTCGGCCACTCCCAGGGCGAAGTCGCCGCGGCCTGCGTCGCCGGGGTGCTCACCCTG
GACGACGCCGCGAAGGTCGTCGCGGTGCGCAGCCGACTCGTCGCCACCGAACTGGCCGGG
CAGGGCGGCATGGTCTCGGTGCCGCCCGCCGACTTCGACGCCGCCGTGTGGGCCGGGCGC
CTGGAGGTCGCCGCGGTCAACGGACCCGCGTCGATCGTTGTCGCCGGTGCGGCCGACGCC
GTGGAGGAGCTGCTGGCCGCCACCCCCCGCGCCCGCCGGATCGCCGTCGACTACGCGTCG
CACACCGCGCATGTCGAAACGATCCGCGGCGCGCTGCTCGACGCTCTCGCCGGCATCACT
CCGCGCACGCCGGACGTCCCGTTCTTCTCCACCGTGGACGAGGCGTGGCTGGACCGGCCC
GCGGACGCCGCCTACTGGTACGACAACCTGCGCCGCACCGTTCGGTTCGCCGCCGCGACC
GGCCACCTGGCGGACCGCGGATACCGCGCGTTCGTCGAGGTCAGCGCGCATCCCGTGCTC
ACCACCGCACTGGAGGACACGCTCGCCGGGCATGCGCATACGGTCGTCACCGGCACACTG
CGGCGAGGCGAGGGCGGCCTGGACCGCTTCACTCGGTCGCTCGCCGCGCTCTGGGTCCGG
GGCGTGCCCGTCACCTGGTCGTTCGCGACGCGTCGGGTGGTGCCGCTGCCCACGTACCCG
TTCCGCCGTGACCGCTACTGGATCGACGCGGAACCGGCGGGAACGTCCGGCCACCCGCTG
CTCGGCTCGTGGGTCGACCTCGCCCGACGGCGAGGGCGCGCTGGCCACCGCGGTGTCTCG
GTACGCCGTCAGCCCTGGCTCGCCGACCACGAGGTGGACGGCCGGGTCATCGTGCCCGGC
TCGGCGCTCGTGGAACTGCTCGCCGAAGCGGGAGCCCGGCTCGGCACGCCGGAGATCGCG
GAGCTGACCATCGTCGCGCCGGTGGTGGTCGACGGCGACGGCGACACGGAGATCCAGGCC
ACCGTCGGAACCGAGGTGTCCGGACGGCGGTCGGTGAGTCTGCACAGCCGTACCGGCACG
GGCCCCTGGGCGCTCAGTGCGACCGGAGCGCTGAGCGTGGACACTGGCGGTCCGGCGGAG
CCCGTGGACTGGCCGCCCGCCGACGCCGACCCGGCCGACCTGACCGGCTTCTACGACGCG
CTGCCGCTCTCGTACGGGCCCGCGTTCCGGGCCATGACCGCGATGTGGACGGGGGAGGGC
CGCGCCTACGCGTCGGTCCGCCTCGCCGAACAGCTCACCGACGCCCGGTACGGGCTGCAC
CCCGTGCTGCTCGACGCGGCCCTGCACGCCCTCGGGACGGTCTTCACGGACCCGGAGCGG
CGCCGGCTGGCGTTCTCCTGGTCCGGCGTGAGGATCCACGCGCGCGCCGCGACCGCGCTG
CGCGTGCTGCTGGAACGCGTCGGCCCCGACATGGTCCGCATCGTCGCCACGGACGAGCAC
GGCTCACCGGTCCTTGACGTCGACAGCCTGACCGTGCGGGCCGCCGACCCCGATGCCGAG
GCGCTGTTCGAGATCGCCTGGGTGCCCGTGCCCGCGTCACCCGTCCCCGACTGGACGTAC
CTCGCCGACGTGCCCGACGGCGAGCACCCCCCGGTCGTGGTCCTGGCCGTGGAACCCGGC
GACCCGGGCACCTCGCCCGGCGCCCGGACCCGGGAGCTGGGCCGCGACCTGCTCACCACC
GTGCAGACCTGGCTCGCCGAGCCGCGCTGGGCGCGATCCCGGCTCATCGTGGCCACCCGT
ACCGGCGATCCCGCGCAGGAAGCGCTCGGCGGCCTGGTCCGGACGGCGGAGACGGAGCAT
CCCGGCCGCGTCGCCCTGATCGAAGCGGACGAGATCACGCCCGCCGCCATAGCGGCCGGG
CTCGCCGCCGGCGACGAGCCGCACGTCCGGGTCGCCGACGGCACAGCGCGTGCGGCCCGT
CTGCGCCGTGTCGCCGCGGCCACCGGAACCTCCCCGCTGACCGGCGGGACCGTCCTCGTC
ACCGGCGGCACCGGCGGGCTCGGCCGCCTCCTCGTGGACCACCTGCTCACCGTGCACGAG
GCCGCCGAGGTCGTCGTGGTGTCCCGCAACGGCCGGCCCGGCGACACGCCGGAGGACGAC
CGCGTGCGGTACGTGGCCGCCGACGTCGTCGACCGCGACGAGCTGGCCGCAGTCGTCGCC
GACGTCGCCCAGCGGCTGCGCGCCGTCGTGCACATGGCCGGGATCGTCGACGACGCGGCC
GTGACGACCATGCGGCCGGAGCAGTGGGACGCCGTGCTGCGGGTCAAGGCGGACGTCGCC
TGGCACCTGCACGAGCTGACGCGCGATCTCGACCTGGCCGCGTTCGTCCTGTACTCGTCC
ATATCCGCCACGTTCGGCGGCGCGGGTCAGGCCAACTACGCGACCGGCAACGCGTTCCTC
GACGCGCTCGCCCGCCACCGGCACCACCAGGGGCTGCCCGCCGTCTCGCTCGCCTGGGGA
CTGTGGGACGCGGCGGACGGGATGGGCGGGCGGCTGACCGCCACCGACCTGGCCCGCATC
GCCCGCAACGGCATGACCCCGATGACGGCCGCACAGGGGCTCGCCCTGTTCGACGCGGCC
CTGCACACCGACCGGCCCGCGCTCGTGCCGATCCGGCTCGACCTCGCCGCCGTCGCCGCG
TCCGACCGGGTCCCGCCGGTCCTACGCACCCTCGTGCCGGCCGTCCGGCGCACGTCCGCA
CCTCCGGCCGCGCGCGACATGCTCGACCTCGTCCGTACCAGCGCTGCCGCGGTGCTCGGC
CACCGCGACGCCCACGCCATCGCACCCGCGCGCGCGTTCAGGGAAGTGGGCTTCGACTCG
CTGACCGGCGTCGAACTGCGCAACCGGCTGGCCGACGCGACGGGCCTGACGCTGCCCGCT
ACGCTCGTCTTCGACCACCCCACGGCGCAGGCGCTCGCCGCCCACCTGGACGAACTGGCC
GGCGCGCGGGCCACCACCCGGCGGCGTACCCCGACCGCGGCCGTCCGGCAGGACGAGCCG
TTGGCGATCGTGGGGATGGCCTGCCGGCTGCCGGGTGGGGTCGCGTCGCCGGAGGACTTG
TGGCGGCTGCTGGAGTCGGGTGGTGACGGGATCACGGCGTTTCCGACGGACCGTGGTTGG
GACGTGGACGGGCTGTACGATCCCGATCCGGATCATCCGGGCACGTCGACCGTGCGTCAT
GGTGGCTTCCTCGCCGGGGTGGCGGACTTCGACGCGGCGTTCTTCGGGATCAGTCCGCGT
GAGGCGCTGGCGATGGACCCGCAGCAGCGTCTGGTCCTGGAGACCTCGTGGGAGGCGCTG
GAACACGCCGGGATCCTCCCGGAGTCGCTGCGCGGAAGCGACACCGGCGTGTTCATGGGC
GGCTACTTCTACGGGTACGGCACTGGAGCCGACCGCGGCGGTTTCGGTGCCACCAGCACC
CAGACCAGTGTGCTGTCCGGTCGGCTGTCGTACTTCTACGGTTTGGAGGGTCCGGCGGTC
ACGGTGGACACGGCGTGTTCGTCGTCGCTGGTGGCGCTGCACCAGGCCGGGCAGTCGCTG
CGCTCGGGGGAGTGCTCGCTCGCCGTGGTCGGCGGCGTCACGGTGATGGCCTCGCCGTCC
GGCTTCGTGGACTTCTCCCAGCAGCGGGGCCTCTCCCCGGACGGCCGCTGCAAGGCGTTC
GCGGATGCGGCTGATGGCACCGGTTTCGCCGAGGGATCCGGTGTGCTGATCGTCGAGAGG
CTCTCCGACGCCGAGCGGCACGGCCACAATGTCCTGGCGGTCGTGCGTGGTTCGGCGGTC
AACCAGGACGGTGCTTCCAACGGGTTGTCGGCGCCGAACGGGCCGTCGCAGGAGCGGGTG
ATCCGGCAGGCGCTGGCCAACGCCGGGCTCACCCCGGCGGATGTGGACGCTGTCGAGGCG
CATGGCACCGGGACCAGGCTGGGCGACCCCATCGAGGCGCAGGCGGTACTGGCCACCTAC
GGGCAGCATCGCGACACCCCGGTGCTGCTGGGCTCGCTGAAGTCCAACATCGGCCACACT
CAGGCCGCCGCGGGCGTCGCCGGTGTCATCAAGATGGTCCTCGCCATGCGGCACGGCACC
CTGCCGCGCACCCTGCACGTGGACACGCCGTCCTCGCACGTCGACTGGACGGCCGGCGCC
GTCGAACTCCTCACCGACGCCCGCCCCTGGCCCGAAACCGACCGCCCACGGCGCGCCGGG
GTGTCCTCCTTCGGCGTTAGCGGCACCAACGCTCACATCATCCTCGAAAGCCACCCCCGA
CCGGCCCCCGAACCCGCCCCGGCACCCGACACCGGACCGCTGCCCCTGCTGCTCTCGGCA
CGCACCCCGCAGGCACTCGACGCACAGGTACACCGCCTGCGCGCCCACCTCGCCACCGGC
GAGGAGGACGAGCGCGCGGTGGCCGCGGCCCTGCTCGCCCGCACGGCCTTCCCGCACCGG
GCCGCGCTGATCGGCACCGACACGGTCACCGGCGCCGCAGAACCGGACCGCCGCCTCGTG
TGGCTCTTCTCCGGACAGGGCTCACAACGTCCCGGCATGGGCGACGGACTGGCCGCCGCC
TACGACGTCTTCGCCCGCACTCGCCGCGAGGTGCTGGACGCCCTCGACGTGCCCGCCGGG
CTCGACCTCCACGACACCGGGTACGCCCAGCCCGCGGTGTTCGCGCTCCAGGTCGCACTC
GGCGCACAGCTCGAGGCGTGGGGCGTACGCCCGGACGCCTTCGTGGGCCATTCGATCGGC
GAGCTGGCCGCCGCGTACGTCGCCGGCGTCTGGTCCCTGGAGGACGCGTGCAGGCTGGTG
TCCGCACGGGCCCGCCTGATGCAGGCGCTGCCGTCCGGCGGGGCGATGGCCGCCGTGATC
GCGTCGGAACGGGACGCGCTGCCGCTGCTGCGGGACGGCGTGGAGATCGCCGCGGTCAAC
GGGCCCGCGTCGATCGTGCTCTCCGGTGACGAGGAGGCGGTGCTCGACGTCGCGGCCCGG
CTCGGCCGCTTCACCCGCCTGCGGACCAGCCACGCGTTCCACTCGGCGCGGATGGAGCCG
ATGCTCGAGGAGTTCCGCAAGGTCGCGGAGAGCCTGACGTACCACGAGCCGAGGATCCCG
ATGGCCGCGGGCGCCGCCTGCACCACGCCGGAGTACTGGGTACGACAGGTCCGCGACACC
GTCCGGTTCGGGGAACAGGTCGCCGCGCACGACGGGGCGGTGCTCCTGGAGATCGGCCCG
GACCGGAGCCTGACCCGACTCGTCGACGGCATCCCGATGCTGCACGCCGACGACGAACCG
CGATCCGCCCTGACCGCGCTCGCCCGGCTGCACACCGACGGCGTCACGGTCGACTGGCCG
AAGGTCATCGACCCCGCGCCGGCACGCGCCTCGCACCCGCCGACGTACCCGTTCGAGCGG
GTCCGCTACTGGCTCGGCACCCAGACCGCGGGCGACGCGGCCCCGGCCGGACAGACGCCG
GTCGCGCACCCGGCGCTGACCGCGGCGGTCACCCTGCCCGGCACCGGCGACCTGGTGCTC
ACCGGCCGGGTCGACGCCGCCGATCCGCTGGCGCACTCCCTGCACGGCCTCGCGGTGCTG
CCCGCCGCGGCCCTCCTGGATCTGGCGATCCGGGCGGGCGACGAAGCCGGCTGCGGCGCC
CTCGACACGTTCACCGTGGACACCCCCCTCACGCTGCCGCGGTCCGGTGCGCTCGCGCTC
TCCGTCACGGTGAGCGCGCCCGGGGCGGACGGCCGCCGCGCGGTCACCGTGCACACGCGG
CACGCGGCGGGGGAGTGGACCGAGCACGCGCACGGAATCCTCGCCCCCGACCCGCGGACG
GCCCCGGCCGTGCGGGAGATGCCGTCGACGTGGCCGCCCGCCACGGCCCGGCCGGTGGAC
CCCGACGACATCGCCGACCGTCTGGCCCGAGCCGGGTACACGGACGGGCCCGCGCTGCCC
CGCCCGCGCGCCGTCTGGGCCGACGACGACGCCGTCTGGGCGGAAGTGGCCCTCGCCGAC
GGACAGCTCGCCGACGCCGGACGGTACGGCCTGCACCCGGCGCTGCTCGGCGCCGCACTC
CGCCTCGCCGCGGAAGGGGACCACCTTCCGTACGCGTTCGACGACGTCCGCGTCCACGCC
ACCGGCGCCACGGCGGTACGCGTCGCCGTCACCGCTGACGGCGTACACCTCGCGGACGAG
ACCGGCGGGCCCGTCGCCACCATCGGCGCCGTGCGCAGGCGCCCCCTGACGATCACGGGA
GCCGTTCCGGGCCTGCTGCGCCCGGTGCTGGCCGAGCTCCCGGAGCTGCCGCCCACGACC
GCGACGACCGGCCGCCTCGACGACCCGACGGTCCCGGACGTGGTGATCCTCCCCGCGCAC
GGCGGCGGCGGTGCCCCGCTCGACGACACCCGCGAACTGGGCGCCGGCGTCCTGACCGCC
GTGCAGCGCTTCCTCACCGACGACCGGTACGCCGACGCGGTCCTGGCCGTCCACACCGGG
CCCGGTCTCGCGTCGGCCGCGGCCGCCGGACTGGTGCGGACCGCGCAGGCCGAACACCCC
GGCCGGATCGTCCTCGTCGACGCCGCCCCGGACACCGCCGAGCCGCTGCTCGCAGCGGCC
ACCGCGCTCGATGAGCCCCAGGTGGTGCTGCGTGACGGCCAGGTGTACGCCCGCCGTCTG
GCCCCGGCGGTCCCGGCGGGTGACGCTCCGGCGCTCGACCCGGACGGCACCGTGCTCGTC
ACCGGTGGCTCCGGGACGCTGGCCGGCATCATCAGCCGCCACCTCGTCGAACGCCACGGC
GTGCGCCGGCTGCTGATGCTGTCGCGCAGCGGCACGGCGAGCGACGTGCCCGGCGCCGAG
GTCACGGCGATCGCCTGCGACGTCGCCGACCGGGACGAACTCGCCTCCGTACTGGCGGGG
ATCGACCCGGCGCACCCGCTCACGGCCGTCGTGCACACCGCGGCCGTCCTCGACGACGGC
GTCCTCACCGCGCTCACCCCCGACCGGCTCGAGACGGTGCTGCGCCCGAAGGTGGACGCC
GCGTGGCACCTGCACGAACTCACCCAGGACACGGAACTGGCCGCGTTCGTCCTCTACTCG
TCGGCCGCCGGTGTGCTCGGCAGCCCCGGACAGGGCAACTACGCGGCCGCGAACGCGTTC
CTCGACGCGCTGGCCGAACAGCGCCGGGCAGCCGGACTGCCCGCGTTGTCCGTGGCCTGG
GGCCTGTGGGAACCGGAGAGCGGGCTGACGGTCGGCACCGGCGCCCGCATGCGCCGCGAC
GGCGTGACGGCGCTGACCGCCGAAGGCGGACTGACGCTGTTCGACGCGGCGTTGCGGTCC
TCGGACCCGGCGCTGGTCGCCGCCGACCCGGCCGGCCTCGGCAGCTCGCCCCTGCTGCGC
GCACCGCGCCGGGAGCCGCGGCGCCGGGCGGCCGGCGCCACCACCCTCGCCGACCGGATC
GCGCGGCTCTCCGCCGCGGACGCCGAAAAGGACGTGCTCGCCGTCGTCCGGCAGTGCACC
GCGGCCGTACTCGGCCACGACGGTGCCGCACGGGTCGAGGCGACCGCCACGTTCAAGGAA
CTCGGCGTCGACTCGCTCATGGCGATCCGGCTGCGCAACGCCTTCACCGAGGCGACGGGC
GTACGGCTGCCCGCCACCGCGGTCTTCGACTTCCCGACGCCGCGCGCCGTCGCGGCGAAG
CTCACCGCGGCGCTGTCCGGCCGGACGGCATCGCCGACCCGCACCACGACCGCGGCCGTC
CGGCAGGACGAGCCGTTGGCGATCGTGGGGATGGCCTGCCGGCTGCCGGGTGGGGTCGCG
TCGCCGGAGGACTTGTGGCGGCTGCTGGAGTCGGGTGGTGACGGGATCACGGCGTTTCCG
ACGGACCGTGGTTGGGACGTGGACGGGCTGTACGATCCCGATCCGGATCATCCGGGCACG
TCGACCGTGCGTCATGGTGGCTTCCTCGCCGGGGTGGCGGACTTCGACGCGGCGTTCTTC
GGGATCAGTCCGCGTGAGGCGCTGGCGATGGACCCGCAGCAGCGTCTGGTCCTGGAGACC
TCGTGGGAGGCGCTGGAACACGCCGGGATCCTCCCGGAGTCGCTGCGCGGAAGCGACACC
GGCGTGTTCATGGGCGCCTTCTCCGACGGGTACGGACTCGGCACCGACCTGGGCGGTTTC
GGCGCGACCGGCACCCAGACCAGTGTGCTGTCCGGTCGGCTGTCGTACTTCTACGGTCTG
GAGGGTCCGGCGGTCACGGTCGACACGGCGTGTTCGTCGTCGCTGGTGGCGCTGCACCAG
GCCGGGCAGTCACTGCGCTCCGGCGAATGCTCGCTCGCCCTGGTCGGCGGCGTCACGGTG
ATGGCCTCGCCGTCCGGCTTCGTCGAGTTCTCCCAGCAGCGGGGTCTCGCGCCCGACGCG
CGCTGCAAGGCGTTCGCGGATGCGGCTGACGGCACCGGTTTCGCCGAGGGGTCCGGTGTG
CTGATCGTCGAGAGGCTCTCCGATGCCGAGCGCAACGGCCACCGTGTGCTGGCGGTTGTC
CGGGGTTCGGCGGTCAACCAGGACGGTGCTTCCAACGGGTTGTCGGCGCCGAACGGGCCC
TCGCAGGAGCGGGTGATCCGGCAGGCCCTGGCCAACGCCGGGCTCACCCCGGCGGACGTG
GACGCCGTGGAGGCGCACGGCACCGGCACCAGGCTGGGCGATCCCATCGAGGCACAGGCG
GTGCTGGCCACCTACGGGCAGGGGCGCGACACCCCGGTGCTGCTGGGCTCGCTGAAGTCC
AACATCGGCCACACTCAGGCCGCCGCGGGTGTCGCCGGTGTCATCAAGATGGTCCTCGCC
ATGCGGCACGGCACCCTGCCGCGCACCCTGCACGTGGACACGCCGTCCTCGCACGTCGAC
TGGACGGCCGGCGCCGTCGAACTCCTCACCGATGCCCGGCCCTGGCCCGAGACCGACCGC
CCGCGGCGCGCCGGTGTGTCCTCCTTCGGCGTCAGCGGCACCAACGCCCACGTCCTGCTG
GAAGCCCACCCGGCCGGGGAGCCGCCGGCCGAGGAGCCGTCGGCCTCGAAGCCCGGTGAG
CCGCTGATCGCCACGCCGCTCACACCACTGCCCGTCTCGGCGCGGACCGCCACGGCCCTC
GACGGCCAGGTCCGCCGACTCCGCGAGCACCTCGCCGCCCGTCCCGGCCACGACCCGCGC
GCCATCGCCGCGGGCCTGCTCGCCAGGCGTACGACGTTCCCGCACCGCGCCGTGCTGCTC
GACGACGACGTCGTCACCGGCACGGCGCTCACCGAGCCGCGCACCGTCTTCGTCTTCCCC
GGACAAGGACCGCAGTGGCGCGGCATGGGCGTCGAACTGATGGCGGCCTCCCCGGTGTTC
GCCGCCAGGATGCGCCAATGCGCCGACGCGCTGATCCCGCACACGGGCTGGGACCCCATC
GCCATGCTCGACGACCCGGAGGTGACCCGCCGCGTCGACGTCGTGCACCCCGTCTGCTGG
GCCGTCATGGTGTCGCTGGCCGCCGTGTGGGAGGCCGCGGGCGTACGCCCGGACGCCGTC
ATCGGACACTCCCAGGGCGAGATCGCCGCGGCCTGTGTCGCCGGAGCGCTCACCCTGGAG
GACGGTGCCCGCCTCGTCGCGCTGCGCAGCGCCCTGCTCCTGCGCGAACTCGCCGGACGC
GGCGCGATGGGCTCGGTCGCGCTCCCGGCCGCCGACGTCGAGGCGGATGCCGCCCGGATC
GACGGCGTCTGGGTCGCGGGCCGCAACGGCGCCACCACCACGACCGTCGCCGGGCGCCCG
GACGCCGTCGAAACGCTGATCGCCGACTACGAGGCCCGCGGCGTCTGGGTGCGCCGCATC
GCCGTCGACTGCCCGACCCACACCCCGTTCGTCGACCCGCTGTACGACGAACTCCAGCGG
ATCGTCGCGGACACCACCTCGCGCACGCCCGAGATCCCGTGGTTCTCCACCGCCGACGAA
CGCTGGATCGACGCGCCGCTCGACGACGAGTACTGGTTCCGCAACATGCGCCACCCCGTA
GGCTTCGCCACGGCCGTGACCGCTGCCCGCGAGCCGGGTGACACCGTGTTCGTCGAGGTC
AGCGCGCACCCCGTGCTGCTGCCCGCGATCGACGGCGCGACCGTCGCCACGCTCCGCCGC
GGCGGGGGAGTCCACCGGCTGCTCACCGCGCTGGCCGAGGCGCACACAACCGGCGTGCCC
GTCGACTGGGCGGCGGTCGTCCCCGCGACGGCGACGGCACACGACCTGCCCACATACGCC
TTCCACCATGAGCGCTACTGGATCGAGACCGCGGCCGGCACGGACGCTTCCGGCCTCGGA
CTCGACGCCGTCGACCACCCGCTGCTCGCCGCGTCGGTGGCGCTCCCCGACTCCGACGAG
GTGCTGCTCACCGGCCGGTTCTCGCTGGCCACCCACCCATGGCTGGCCGGTCACTCCGTC
GACGGCGCCGTACTGCTGCCCGGACCCGCCTTCCTGGAATTGGCCGGACGCGGCGCCGAC
GAGGCAGGCTGCGACCTGCTCGACGAACTGGTCGTCGAGACACCGCTGGTCCTGCCCGCC
ACCGGCGCCGTCCAGGTGCGCGTGACCGTCGCCGCGCCCGACGACACCGGACGCCGTGCC
GTGCGCGTCCACGCCCGGACGGACGGCGACCGGACATGGACCCGCCACGCCTCCGGCTTC
GCCGGCATCGCCACCACCGAACCGGCCACCACGCCGGGGCCCTGGCCGCCCGAGCACGCG
GAACCGGTCGACGTCGCGGCCTTCTACCAGCGACTCGACGACGCGGGATACGAGTTCGGC
CCCGAGTTCCGCGGCATGTCCGCCGCGTGGAGCCACGGAGACACCGTCTGCGCCGAAGTC
GCCCTCGACGGCGCCCTCGCCAGGGACGCCGCCCGCTACACACTGCACCCGGCGCTGCTC
GTCACCGCGCTGCAAGCGGGCAGCATCGGCGCGGCCGCCGAGAACGCGGGGGTACGGTTG
CCGTTCGCGTTCACCGGCGTCCGTGTCCACACCAGCGGCGCCACGAAACTGCGCGTCACC
TTCGTCCACGGCGAGGGCGAGGGCGGCGCCCGCGTGCACCTCGCCGACGAACTGGGACGG
CCGGTGGCTCAGATCGGCTCGCTCATCACCCGGCCCCCCGCCACGACGGGCCCGGACGGG
GACGTGCGGCTGTTCCGGCGCACCTGGACCGGCGTCCGGGCCCCGGCGGCACCCGGCACC
ACGGCCCGCCGGTACACCGACCTCGGCGACGACGCCACGCCCGACGTCATCGTCGTCCCG
GTATCCGGTCCCGACGAGGTCCGTACCGCACTGGACGACCCGAGGACCGCCGGCGCCACG
CTGGTGGTGTCCGCCGAGGCCGGGCCCGTCGCCGGTGCCGTCGCCGCACTGCTCGACACC
GCGGAACCGGGCCGGCTCGTGCTCGTGGAGACCACCGACACGGTCACCCCCCGCCGCGCC
GCCGCCCTCTCCCGCCTCGACGAACCGCACCTGCGCCTGGCCGACGGGCGCCTCGAAGCG
CCCCGCCTCGTCCCCGCCGCGCCCACCACGGCCGCGGCCTCGTACGGCGACACCGTCCTC
CTCGCGGGCGGTTCGGAGGAACTCGCCGGACACCTCGGCGGACACGGCGCCGAAGTGATC
CGGTACGAGCCGGGCACAGTGCCGGAAACCCCGGTGACCGCGGTCGTCCACGCGGACGGC
ACCGCCGAGTCGGCCTGGGAACTGCACCGCCTGACCCGCGACCTCGACCTGACCGCGTTC
GTTCTCGCCGTTCCGTCCGGCGAGGCGGCCGGACCGCTCCAGGCCCTGGCCGACCTGCGC
CGGGCACAAGGCCTGCCGGCCGTGGCGTTCACCGCCGCGGCGGACCGGCTGACCGACCTC
CTCGACGCCGCGTGCGCCACCGGGGAAGCCGTGGTCGTGGCGACCGCCCCACCCGGGCCC
GGCGACCCGTCACCGCTGTGGCGACCGATCCAGCGCCCCACCCGGCGCTCCGCGACCGAC
GGCGGCTCCCTGCTGGAACGCCTGCCGGACCTGCCCCACAAGGAACGGGAACAGGTGCTG
CTCGGCGTCGTCCGCGACACCGCCGCCACCCTGCTGGGCCACACCGACGCGGCGGCGGTC
ACGGCCACCACGGCGTTCAAGGACCTCGGGGTCGACTCGCTCACCGCGCTCGGCCTGCGC
AACCGGCTCTCCGAGGCCCTCGGCATTCCGCTGCCGGCCACGCTCGTCTTCGACTATCCC
GCCGCCGGCGCGCTCACCCGTCATCTGCTGACCCTCCTGGCCCCGGACGTCAACGGGACC
CCGGACGACAACGGGACCCCGGACGGCGGTGAACCACCGGCACAGGCACCCGCGAGCACC
ACGACCGCGGAGCCGGACGACGAACTGTTCGACGACATGGACGCAGACGCGCTCATCGCG
CACGTGCTGAAGGGATGA
[0] A35..435
[0] ER627..918
[0] PCP1074..1144
[1] KS1161..1529
[1] AT1660..1930
[1] methylmalonyl-CoA1844..1848
[1] DH2006..2172
[1] KR2427..2588
[1] ACP2665..2735
[2] KS2760..3129
[2] AT3274..3583
[2] methylmalonyl-CoA3458..3462
[2] dh3618..3772
[2] KR4036..4205
[2] ACP4287..4357
[3] KS4379..4748
[3] AT4880..5119
[3] malonyl-CoA5051..5055
[3] dh5203..5365
[3] KR5616..5786
[3] ACP5868..5942
[4] KS5964..6333
[4] AT6476..6780
[4] ethylmalonyl-CoA6636..6640
[4] dh6826..6986
[4] ACP7400..7470
[0] A103..1305
[0] ER1879..2754
[0] PCP3220..3432
[1] KS3481..4587
[1] AT4978..5790
[1] methylmalonyl-CoA5530..5544
[1] DH6016..6516
[1] KR7279..7764
[1] ACP7993..8205
[2] KS8278..9387
[2] AT9820..10749
[2] methylmalonyl-CoA10372..10386
[2] dh10852..11316
[2] KR12106..12615
[2] ACP12859..13071
[3] KS13135..14244
[3] AT14638..15357
[3] malonyl-CoA15151..15165
[3] dh15607..16095
[3] KR16846..17358
[3] ACP17602..17826
[4] KS17890..18999
[4] AT19426..20340
[4] ethylmalonyl-CoA19906..19920
[4] dh20476..20958
[4] ACP22198..22410

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [35-435]  5.09999999999993e-102 PF00501
PF00501   AMP-binding
IPR001227 Acyl transferase domain (Domain)
 [1653-1780]  G3DSA:3.40.366.10 [1844-1948]  G3DSA:3.40.366.10 [3265-3397]  G3DSA:3.40.366.10 [3458-3572]  G3DSA:3.40.366.10 [4870-4990]  G3DSA:3.40.366.10 [5051-5132]  G3DSA:3.40.366.10 [6468-6596]  G3DSA:3.40.366.10 [6664-6761]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [2428-2574]  2.50000000000001e-40 PF00106 [4036-4192]  5.30000000000001e-47 PF00106 [5616-5773]  7.69999999999997e-55 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [2693-2708]  PS00012 [4315-4330]  PS00012 [5900-5915]  PS00012 [7428-7443]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1072-1145]  6.29999999999998e-102 G3DSA:1.10.1200.10 [2664-2738]  6.29999999999998e-102 G3DSA:1.10.1200.10 [4286-4359]  6.29999999999998e-102 G3DSA:1.10.1200.10 [5870-5946]  6.29999999999998e-102 G3DSA:1.10.1200.10 [7400-7473]  6.29999999999998e-102 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1077-1143]  1.5e-10 PF00550 [2669-2734]  4.9e-14 PF00550 [4290-4356]  6.90000000000001e-12 PF00550 [5875-5939]  3.90000000000001e-12 PF00550 [7404-7469]  3.2e-10 PF00550
PF00550   PP-binding
 [1067-1177]  1.89999859865865e-23 SSF47336 [2658-2776]  6.09999977126211e-28 SSF47336 [4279-4374]  6.30000946287306e-21 SSF47336 [5865-5980]  5.20000089003336e-26 SSF47336 [7392-7487]  4.09999599045784e-21 SSF47336
SSF47336   ACP_like
 [1074-1144]  PS50075 [2665-2735]  PS50075 [4287-4357]  PS50075 [5868-5942]  PS50075 [7400-7470]  PS50075
PS50075   ACP_DOMAIN
IPR011032 GroES-like (Domain)
 [620-763]  4.00000300869883e-30 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [649-703]  3e-07 PF08240
PF08240   ADH_N
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [1161-1405]  1.5e-91 PF00109 [2760-3005]  5.59999999999999e-90 PF00109 [4379-4624]  4.30000000000003e-93 PF00109 [5964-6209]  7.5e-93 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [1413-1529]  3.2e-47 PF02801 [3013-3129]  1.6e-47 PF02801 [4632-4748]  2.50000000000001e-49 PF02801 [6217-6333]  6.09999999999996e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [1660-1930]  6.90000000000007e-85 PF00698 [3274-3583]  2.59999999999995e-98 PF00698 [4880-5119]  1.2e-41 PF00698 [6476-6780]  3.99999999999998e-82 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1658-1931]  4.30000170645869e-53 SSF52151 [3272-3556]  1e-63 SSF52151 [4878-5132]  5.40001756046195e-54 SSF52151 [6474-6772]  1e-58 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [1783-1843]  1.59999889349252e-15 SSF55048 [3400-3457]  1.49999977583352e-11 SSF55048 [4992-5050]  5.20000089003336e-13 SSF55048 [6599-6663]  9.20000434662057e-14 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [1163-1417]  G3DSA:3.40.47.10 [1418-1580]  G3DSA:3.40.47.10 [2759-3015]  G3DSA:3.40.47.10 [3017-3179]  G3DSA:3.40.47.10 [4378-4635]  G3DSA:3.40.47.10 [4636-4800]  G3DSA:3.40.47.10 [5963-6220]  G3DSA:3.40.47.10 [6221-6384]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1153-1527]  1.59998835313644e-97 SSF53901 [2752-3127]  1.79999754022378e-100 SSF53901 [4371-4800]  9.90001804798383e-105 SSF53901 [5956-6385]  3.49999466863949e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [763-865]  1.6e-15 G3DSA:3.40.50.720 [2465-2594]  4.69999999999992e-92 G3DSA:3.40.50.720 [4032-4212]  4.69999999999992e-92 G3DSA:3.40.50.720 [5616-5792]  4.69999999999992e-92 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1318-1334]  PS00606 [2918-2934]  PS00606 [4537-4553]  PS00606 [6122-6138]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [1662-1954]  7.0999832511256e-96 SM00827 [3276-3564]  3.79997359309398e-108 SM00827 [4882-5192]  3.39999972437719e-99 SM00827 [6478-6762]  6.00001679190159e-96 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1075-1147]  1.89999859865865e-24 SM00823 [2666-2738]  1.70000295590054e-29 SM00823 [4288-4360]  1e-30 SM00823 [5873-5945]  5.49999338756182e-31 SM00823 [7401-7473]  1.50000306971104e-27 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2006-2172]  2.7000136937899e-78 SM00826 [3618-3772]  2.9000035467798e-47 SM00826 [5203-5365]  5.59999989417026e-45 SM00826 [6826-6986]  8.10000734323267e-76 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [1163-1581]  SM00825 [2762-3180]  SM00825 [4381-4800]  SM00825 [5966-6385]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2427-2588]  1.20000117458134e-40 SM00822 [4036-4205]  5.09998762524166e-44 SM00822 [5616-5786]  3.39999972437719e-57 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [627-918]  SM00829
SM00829   PKS_ER
IPR020845 AMP-binding, conserved site (Conserved_site)
 [165-176]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit