close all open/close all

CDS information : Asco_00150


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction46,752 / 47,786 / + [in whole cluster]
46,752 / 47,786 / + [in contig]
Location46752..47786 [in whole cluster]
46752..47786 [in contig]
TypeCDS
Length1,035 bp (344 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productchorismatase
chorismate hydrolase
Product (GenBank)FkbO
Gene
Gene (GenBank)fkbO
EC number
Keyword
  • 4,5-dihydroxycyclohex-1-ene carboxylic acid
Note
Note (GenBank)
  • 9-hydroxyl oxidase
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
[21383123] Biosynthesis of the immunosuppressants FK506, FK520, and rapamycin involves a previously undescribed family of enzymes acting on chorismate. (Proc Natl Acad Sci U S A. , 2011)
[24036425] Mechanistic implications for the chorismatase FkbO based on the crystal structure. (J Mol Biol. , 2014)
[26247872] Chorismatase Mechanisms Reveal Fundamentally Different Types of Reaction in a Single Conserved Protein Fold. (J Am Chem Soc. , 2015)

close this sectionSequence

selected fasta
>chorismatase [FkbO]
MTDAGRQGRVEALSISVTAPYCRFEKTGSPDLEGDETVLGLIEHGTGHTDVSLVDGAPRT
AVHTTTRDDEAFTEVWHAQRPVESGMDNGIAWARTDAYLFGVVRTGESGRYADATAALYT
NVFQLTRSLGYPLLARTWNYVSGINTTNADGLEVYRDFCVGRAQALDEGGIDPATMPAAT
GIGAHGGGITCVFLAARGGVRINIENPAVLTAHHYPTTYGPRPPVFARATWLGPPEGGRL
FISATAGILGHRTVHHGDVTGQCEVALDNMARVIGAENLRRHGVQRGHVLADVDHLKVYV
RRREDLDTVRRVCAARLSSTAAVALLHTDIAREDLLVEIEGMVA
selected fasta
>chorismatase [FkbO]
ATGACCGATGCCGGACGCCAGGGAAGGGTGGAGGCGTTGTCCATATCTGTCACGGCGCCG
TATTGCCGCTTCGAGAAGACCGGATCACCGGACCTCGAGGGTGACGAGACGGTGCTCGGC
CTGATCGAGCACGGCACCGGCCACACCGACGTGTCGCTGGTGGACGGTGCTCCCCGGACC
GCCGTGCACACCACGACCCGTGACGACGAGGCGTTCACCGAGGTCTGGCACGCACAGCGC
CCTGTCGAGTCCGGCATGGACAACGGCATCGCCTGGGCCCGCACCGACGCGTACCTGTTC
GGTGTCGTGCGCACCGGCGAGAGCGGCAGGTACGCCGATGCCACCGCGGCCCTCTACACG
AACGTCTTCCAGCTCACCCGGTCGCTGGGGTATCCCCTGCTCGCCCGGACCTGGAACTAC
GTCAGCGGTATCAACACGACGAACGCGGACGGGCTGGAGGTGTACCGGGACTTCTGCGTG
GGCCGCGCCCAGGCGCTCGACGAGGGCGGGATCGACCCGGCCACCATGCCCGCGGCCACC
GGTATCGGCGCCCACGGGGGCGGCATCACCTGCGTGTTCCTCGCCGCCCGGGGCGGAGTG
CGGATCAACATCGAGAACCCCGCCGTCCTCACGGCCCACCACTACCCGACGACGTACGGT
CCGCGGCCCCCGGTCTTCGCACGGGCCACCTGGCTGGGCCCGCCGGAGGGGGGCCGGCTG
TTCATCTCCGCGACGGCCGGCATCCTCGGACACCGAACGGTGCACCACGGTGATGTGACC
GGCCAGTGCGAGGTCGCCCTCGACAACATGGCCCGGGTCATCGGCGCGGAGAACCTGCGG
CGCCACGGCGTCCAGCGGGGGCACGTCCTCGCCGACGTGGACCACCTCAAGGTCTACGTC
CGCCGCCGCGAGGATCTCGATACGGTCCGCCGGGTCTGCGCCGCACGCCTGTCGAGCACC
GCGGCCGTCGCCCTTTTGCACACCGACATAGCCCGCGAGGATCTGCTCGTCGAAATCGAA
GGCATGGTGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013813 Endoribonuclease L-PSP/chorismate mutase-like (Domain)
 [226-343]  5.29999999999999e-11 G3DSA:3.30.1330.40
G3DSA:3.30.1330.40   Endoribo_LPSP/chorism_mut-like
 [213-344]  2.2999993566538e-11 SSF55298
SSF55298   YjgF/chorismate_mutase-like
SignalP No significant hit
TMHMM No significant hit