close all open/close all

CDS information : Asco_00160


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction47,783 / 52,270 / + [in whole cluster]
47,783 / 52,270 / + [in contig]
Location47783..52270 [in whole cluster]
47783..52270 [in contig]
TypeCDS
Length4,488 bp (1,495 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)FkbP
Gene
Gene (GenBank)fkbP
EC number
Keyword
Note
Note (GenBank)
  • non-ribosomal peptide synthetase
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
[15835888] Elucidating the substrate specificity and condensation domain activity of FkbP, the FK520 pipecolate-incorporating enzyme. (Biochemistry. , 2005)

close this sectionPKS/NRPS Module

11 L-pipecolate
12
C33..323
A510..912
PCP998..1065
C1081..1360

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [FkbP]
MTIPGKRPATLRLGGSAKRKKSVTAQRGSPVLSSFAQRRIWFLQQLDPESNAYNLPLVQR
LRGLLDAPALERALALVVARHEALRTVFDTADGEPLQRVLPAPEHLLRHARAGSEEDAAR
LVRDEIAAPFDLATGPLIRALLIRLGDDDHVLAVTVHHVAGDGWSFGLLQHELAAHYTAL
RDTARPAELPPLPVQYADFAAWERRELTGAGLDRRLAYWREQLRGAPARLALPTDRPRPP
VADADAGMAEWRPPAALATAVLTLARDSGASVFMTLLAAFQAVLARQAGTRDVLVGTPVA
NRTRAAYEGLIGMFVNTLALRGDLSGDPSFRELLDRCRATTTDAFAHADLPFENVIELVA
PERDLSVNPVVQVLLQVLRRDAATAALPGIAAEPFRTGRWFTRFDLEFHVYEEPGGALTG
ELLYSRALFDEPRITGLLEEFTAVLQAVTADPDVRLSRLPAGDATAAAPVVPSNDTARDL
PVDTLPGLLARYAARTPGAVAVTDPHISLTYAQLDRRANRLAHLLRARGTATGDLVGICA
DRGADLIVGIVGILKAGAAYVPLDPEHPPERTAFVLADAQLTTVVAHEVYRSRFPDVPHV
VALDDPELDRQPDDTAPDVELDRDSLAYAIYTSGSTGRPKAVLMPGVSAVNLLLWQERTM
GREPASRTVQFVTPTFDYSVQEIFSALLGGTLVIPPDEVRFDPPGLARWMDEQAITRIYA
PTAVLRALIEHVDPHSDQLAALRHLCQGGEALILDARLRELCRHRPHLRVHNHYGPAESQ
LITGYTLPADPDAWPATAPIGPPIDNTRIHLLDEAMRPVPDGMPGQLCVAGVGLARGYLA
RPELTAERWVPGDAVGEERMYLTGDLARRAPDGDLEFLGRIDDQVKIRGIRVEPGEIESL
LAEDARVTQAAVSVREDRRGEKFLAAYVVPVAGRHGDDFAASLRAGLAARLPAALVPSAV
VLVERLPRTTSGKVDRRALPDPEPGPASTGAVTPRTDAERTVCRIFQEVLDVPRVGADDD
FFTLGGHSLLATRVVSRIRAELGADVPLRTLFDGRTPAALARAADEAGPAALPPIAPSAE
NGPAPLTAAQEQMLHSHGSLLAAPSYTVAPYGFRLRGPLDREALDAALTRIAARHEPLRT
GFRDREQVVRPPAPVRAEVVPVPVGDVDAAVRVAHRELTRPFDLVNGSLLRAVLLPLGAE
DHVLLLMLHHLAGDGWSFDLLVRELSGTQPDLPVSYTDVARWERSPAVIAARENDRAYWR
RRLGGATAPELPAVRPGGAPTGRAFLWTLKDTAVLAARRVADAHDATLHETVLGAFALVV
AETADTDDVLVATPFADRGYAGTDHLIGFFAKVLALRLDLGGTPSFPEVLRRVHTAMVGA
HAHQAVPYSALRAEDPALPPAPVSFQLISALSAELRLPGMHTEPFPVVAETVDEMTGELS
INLFDDGRTVSGAVVHDAALLDRATVDDLLTRVEATLRAAAGDLTVRVTGYVESE
selected fasta
>non-ribosomal peptide synthetase [FkbP]
GTGACAATACCCGGTAAAAGGCCCGCGACGCTGCGCCTCGGCGGATCCGCGAAGAGAAAG
AAGAGCGTCACCGCACAGCGCGGCAGCCCGGTCCTTTCGTCCTTCGCACAGCGGCGGATC
TGGTTTCTCCAGCAATTGGACCCGGAGAGCAACGCCTATAATCTCCCGCTCGTGCAACGC
CTGCGCGGTCTATTGGACGCGCCGGCCCTGGAGCGTGCGCTGGCGCTCGTCGTCGCGCGC
CACGAGGCGTTGCGGACGGTGTTCGACACCGCCGACGGCGAGCCCCTCCAGCGGGTGCTT
CCCGCCCCGGAACACCTCCTGCGCCACGCGCGGGCGGGCAGCGAGGAGGACGCCGCCCGG
CTCGTCCGCGACGAGATCGCCGCGCCGTTCGACCTCGCCACCGGGCCGTTGATCAGGGCC
CTGCTGATCCGCCTCGGTGACGACGACCACGTTCTCGCGGTGACCGTGCACCATGTCGCC
GGCGACGGCTGGTCGTTCGGGCTCCTCCAACATGAACTCGCAGCCCACTACACGGCGCTG
CGCGACACTGCCCGCCCTGCCGAACTGCCGCCGTTGCCGGTGCAGTACGCCGACTTCGCC
GCCTGGGAGCGGCGCGAACTCACCGGCGCCGGACTGGACAGGCGTCTGGCCTACTGGCGC
GAGCAACTCCGGGGCGCCCCGGCGCGGCTCGCCCTCCCCACCGACCGTCCCCGCCCGCCG
GTCGCCGACGCGGACGCGGGCATGGCCGAGTGGCGGCCGCCGGCCGCGCTGGCCACCGCG
GTCCTCACGCTCGCGCGCGACTCCGGTGCGTCCGTGTTCATGACCCTGCTGGCGGCCTTC
CAAGCGGTCCTCGCCCGGCAGGCGGGCACGCGGGACGTGCTGGTCGGCACGCCCGTGGCG
AACCGTACGCGGGCGGCGTACGAGGGCCTGATCGGCATGTTCGTCAACACGCTCGCGCTG
CGCGGCGACCTCTCGGGCGATCCGTCGTTCCGGGAACTCCTCGACCGCTGCCGGGCCACG
ACCACGGACGCGTTCGCCCACGCCGACCTGCCGTTCGAGAACGTCATCGAACTCGTCGCA
CCGGAACGCGACCTGTCGGTCAACCCGGTCGTCCAGGTGCTGTTGCAGGTGCTGCGGCGC
GACGCGGCGACGGCCGCGCTGCCCGGCATCGCGGCCGAACCGTTCCGCACCGGACGCTGG
TTCACCCGCTTCGACCTCGAATTCCATGTGTACGAGGAGCCGGGTGGCGCGCTGACCGGC
GAACTGCTCTACAGCCGTGCGCTGTTCGACGAGCCACGGATCACGGGGTTGCTGGAGGAG
TTCACGGCGGTGCTTCAGGCGGTCACCGCCGACCCGGACGTACGGCTGTCGCGGCTGCCG
GCCGGCGACGCGACGGCGGCAGCGCCCGTGGTGCCCTCGAACGACACGGCGCGGGACCTG
CCCGTCGACACGCTGCCGGGCCTGCTGGCCCGGTACGCCGCACGCACCCCCGGCGCCGTG
GCCGTCACCGACCCGCACATCTCCCTCACCTACGCGCAGCTGGACCGGCGGGCGAACCGC
CTCGCGCACCTGCTCCGCGCGCGCGGCACCGCCACCGGCGACCTGGTCGGGATCTGCGCC
GATCGCGGCGCCGACCTGATCGTCGGCATCGTGGGGATCCTCAAGGCGGGCGCCGCTTAT
GTGCCGCTGGACCCCGAACATCCTCCGGAGCGCACGGCGTTCGTGCTGGCCGACGCGCAG
CTGACCACGGTGGTGGCGCACGAGGTCTACCGTTCCCGGTTCCCCGATGTGCCGCACGTG
GTGGCGTTGGACGACCCGGAGCTGGACCGGCAGCCGGACGACACGGCGCCGGACGTCGAG
CTGGACCGGGACAGCCTCGCCTACGCGATCTACACGTCCGGGTCGACCGGCAGGCCGAAG
GCCGTGCTCATGCCGGGTGTCAGCGCCGTCAACCTGCTGCTCTGGCAGGAGCGCACGATG
GGCCGCGAGCCGGCCAGCCGCACCGTCCAGTTCGTGACGCCCACGTTCGACTACTCGGTG
CAGGAGATCTTTTCCGCGCTGCTGGGCGGCACGCTCGTCATCCCGCCGGACGAGGTGCGG
TTCGACCCGCCGGGACTCGCCCGGTGGATGGACGAACAGGCGATTACCCGGATCTACGCG
CCGACGGCCGTACTGCGCGCGCTGATCGAGCACGTCGATCCGCACAGCGACCAGCTCGCC
GCCCTGCGGCACCTGTGCCAGGGCGGCGAGGCGCTGATCCTCGACGCGCGGTTGCGCGAG
CTGTGCCGGCACCGGCCCCACCTGCGCGTGCACAATCACTACGGTCCGGCCGAAAGCCAG
CTCATCACCGGGTACACGCTGCCCGCCGACCCCGACGCGTGGCCCGCCACCGCACCGATC
GGCCCGCCGATCGACAACACCCGCATCCATCTGCTCGACGAGGCGATGCGGCCGGTTCCG
GACGGTATGCCGGGGCAGCTCTGCGTCGCCGGCGTCGGCCTCGCCCGTGGGTACCTGGCC
CGTCCCGAGCTGACCGCCGAGCGCTGGGTGCCGGGAGATGCGGTCGGCGAGGAGCGCATG
TACCTCACCGGCGACCTGGCCCGCCGCGCGCCCGACGGCGACCTGGAATTCCTCGGCCGG
ATCGACGACCAGGTCAAGATCCGCGGCATCCGCGTCGAACCGGGTGAGATCGAGAGCCTG
CTCGCCGAGGACGCCCGCGTCACGCAGGCGGCGGTGTCCGTGCGCGAGGACCGGCGGGGC
GAGAAGTTCCTGGCCGCGTACGTCGTACCGGTGGCCGGCCGGCACGGCGACGACTTCGCC
GCGTCGCTGCGCGCGGGACTGGCCGCCCGGCTGCCCGCCGCGCTCGTGCCCTCCGCCGTC
GTCCTGGTGGAGCGACTGCCGAGGACCACGAGCGGCAAGGTGGACCGGCGCGCGCTGCCC
GACCCGGAGCCGGGCCCGGCGTCGACCGGGGCGGTTACGCCCCGCACCGATGCCGAGCGG
ACGGTGTGCCGGATCTTCCAGGAGGTGCTCGACGTCCCGCGGGTCGGTGCCGACGACGAC
TTCTTCACGCTCGGCGGGCACTCCCTGCTCGCCACCCGGGTCGTCTCCCGCATCCGCGCC
GAGCTGGGTGCCGATGTCCCGCTGCGTACGCTCTTCGACGGGCGGACGCCCGCCGCGCTC
GCCCGTGCGGCGGACGAGGCCGGCCCGGCCGCCCTGCCCCCGATCGCGCCCTCCGCGGAG
AACGGGCCGGCCCCCCTCACCGCGGCACAGGAACAGATGCTGCACTCGCACGGCTCGCTG
CTCGCCGCGCCCTCCTACACGGTCGCCCCGTACGGGTTCCGGCTGCGCGGGCCACTCGAC
CGCGAAGCGCTCGACGCGGCACTGACCCGGATCGCCGCGCGCCACGAGCCGCTGCGGACC
GGGTTCCGCGATCGGGAACAGGTCGTCCGGCCGCCCGCTCCGGTGCGCGCCGAGGTGGTT
CCGGTGCCGGTCGGCGACGTCGACGCCGCGGTCCGGGTCGCCCACCGGGAGCTGACCCGG
CCGTTCGACCTCGTGAACGGGTCGTTGCTGCGTGCCGTGCTGCTGCCGCTGGGCGCCGAG
GATCACGTGCTGCTGCTGATGCTGCACCACCTCGCCGGTGACGGATGGTCCTTCGACCTC
CTGGTCCGGGAGTTGTCGGGGACGCAACCGGACCTTCCGGTGTCCTACACGGACGTGGCC
CGGTGGGAACGGAGTCCGGCCGTGATCGCGGCCAGGGAGAACGACCGGGCCTACTGGCGC
CGGCGGCTGGGGGGCGCCACCGCGCCGGAGCTGCCCGCGGTCCGGCCCGGCGGGGCACCG
ACCGGGCGGGCGTTCCTGTGGACGCTCAAGGACACCGCCGTCCTGGCGGCACGCCGGGTC
GCGGACGCCCACGACGCGACGTTGCACGAAACCGTGCTCGGCGCCTTCGCCCTGGTCGTG
GCGGAGACCGCCGACACCGACGACGTGCTCGTCGCGACGCCGTTCGCGGACCGGGGGTAC
GCCGGGACCGACCACCTCATCGGCTTCTTCGCGAAGGTCCTCGCGCTGCGCCTCGACCTC
GGCGGCACGCCGTCGTTCCCCGAGGTGCTGCGCCGGGTGCACACCGCGATGGTGGGCGCG
CACGCCCACCAGGCGGTGCCCTACTCCGCGCTGCGCGCCGAGGACCCCGCGCTGCCGCCG
GCCCCCGTGTCGTTCCAGCTCATCAGCGCGCTCAGCGCGGAACTGCGGCTGCCCGGCATG
CACACCGAGCCGTTCCCCGTCGTCGCCGAGACCGTCGACGAGATGACCGGCGAACTGTCG
ATCAACCTCTTCGACGACGGTCGCACCGTCTCCGGCGCGGTGGTCCACGATGCCGCGCTG
CTCGACCGTGCCACCGTCGACGATTTGCTCACCCGGGTGGAGGCGACGCTGCGTGCCGCC
GCGGGCGACCTCACCGTACGCGTCACCGGTTACGTGGAAAGCGAGTAG
[11] C33..323
[11] A510..912
[11] L-pipecolate677..782
[11] PCP998..1065
[12] C1081..1360
[11] C97..969
[11] A1528..2736
[11] L-pipecolate2029..2346
[11] PCP2992..3195
[12] C3241..4080

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [510-912]  9.2000000000001e-105 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [33-323]  4.89999999999996e-72 PF00668 [1081-1360]  1.29999999999998e-39 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1023-1038]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [998-1065]  PS50075
PS50075   ACP_DOMAIN
 [1001-1062]  6.3e-14 PF00550
PF00550   PP-binding
 [988-1067]  3.3e-27 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [991-1066]  8.70001261213513e-20 SSF47336
SSF47336   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [510-912]  4.2e-124 TIGR01733
TIGR01733   AA-adenyl-dom
IPR025110 Domain of unknown function DUF4009 (Domain)
 [956-981]  2.9e-07 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit