close all open/close all

CDS information : Asco_00170


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction52,273 / 71,463 / + [in whole cluster]
52,273 / 71,463 / + [in contig]
Location52273..71463 [in whole cluster]
52273..71463 [in contig]
TypeCDS
Length19,191 bp (6,396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)FkbA
Gene
Gene (GenBank)fkbA
EC number
Keyword
Note
Note (GenBank)
  • PKS modules 7 through 10
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
[11786554] A new substrate specificity for acyl transferase domains of the ascomycin polyketide synthase in Streptomyces hygroscopicus. (J Biol Chem. , 2002)

close this sectionPKS/NRPS Module

7 methoxymalonyl-ACP
8 methoxymalonyl-ACP
9 methylmalonyl-CoA
10 malonyl-CoA
KS30..386
AT520..747
DH832..993
ER1257..1551
KR1561..1722
ACP1809..1883
KS1906..2274
AT2407..2642
dh2720..2853
KR3096..3257
ACP3352..3422
KS3443..3812
AT3942..4214
DH4288..4457
ER4717..5003
KR5013..5174
ACP5274..5344
KS5374..5745
AT5902..6210
ACP6264..6334

close this sectionSequence

selected fasta
>polyketide synthase [FkbA]
MPEQDKTVEYLRWATAELQKTRAELAAHSEPLAIVGMACRLPGGVASPEDLWQLLESGGD
GITAFPTDRGWETTADGRGGFLTGAAGFDAAFFGISPREALAMDPQQRLALETSWEAFEH
AGIDPQTLRGSDTGVFLGAFFQGYGIGADFDGYGTTSIHTSVLSGRLAYFYGLEGPAVTV
DTACSSSLVALHQAGQSLRSGECSLALVGGVTVMASPAGFADFSEQGGLAPDARCKAFAE
AADGTGFAEGSGVLIVEKLSDAERNGHRVLAVVRGSAVNQDGASNGLSAPNGPSQERVIR
QALANAGLTPADVDAVEAHGTGTRLGDPIEAQAVLATYGQGRDTPVLLGSLKSNIGHTQA
AAGVAGVIKMVLAMRHGTLPRTLHVDTPSSHVDWTAGAVELLTDARPWPETDRPRRAGVS
SFGVSGTNAHIILESHPRPAPEPAPAPDTGPLPLLLSARTPQALDAQVHRLRAFLDDNPG
ADRVAVAQTLARRTQFEHRAVLLGDTLITVSPNAGRGPVVFVYSGQSTLHPHTGRQLAST
YPVFAEAWREALDHLDPTQGPATHFAHQTALTALLRSWGITPHAVIGHSLGEITAAHAAG
VLSLRDAGALLTTRTRLMDQLPSGGAMVTVLTSEEKARQVLRPGVEIAAVNGPHSLVLSG
DEEAVLEAARQLGIHHRLPTRHAGHSERMQPLVAPLLDVARTLTYHQPHTAIPGDPTTAE
YWAHQVRDQVRFQAHTEQYPGATFLEIGPNQDLSPLVDGVAAQTGTPDEVRALHTALAQL
HVRGVAIDWTLVLGGDRAPVTLPTYPFQHKDYWLRPTSRADVTGAGQEQVAHPLLGAAVA
LPGTGGVVLTGRLSLASHPWLGEHAVDGTVLLPGAAFLELAARAGDEVGCDLLHELVIET
PLVLPATGGVAVSVEIAEPDDTGRRAVTVHARADGSGLWTRHAGGFLGTAPAPATATDPA
PWPPAEAGPVDVADVYDRFEDIGYSYGPGFRGLRAAWRAGDTVYAEVALPDEQSADAARF
TLHPALLDAAFQAGALAALDAPGGAARLPFSFQDVRIHAAGATRLRVTVGRDGERSTVRM
TGPDGQLVAVVGAVLSRPYAEGSGDGLLRPVWTELPMPVPSADDPRVEVLGADPGDGDVP
AATRELTARVLGALQRHLSAAEDTTLVVRTGTGPAAAAAAGLVRSAQAENPGRVVLVEAS
PDTSVELLAACAALDEPQLAVRDGVLFAPRLVRMSDPAHGPLSLPDGDWLLTRSASGTLH
DVALIADDTPRRALEAGEVRIDVRAAGLNFRDVLIALGTYTGATAMGGEAAGVVVETGPG
VDDLSPGDRVFGLTRGGIGPTAVTDRRWLARIPDGWSFTTAASVPIVFATAWYGLVDLGT
LRAGEKVLVHAATGGVGMAAAQIARHLGAELYATASTGKQHVLRAAGLPDTHIADSRTTA
FRTAFPRMDVVLNALTGEFIDASLDLLDADGRFVEMGRTELRDPAAIVPAYLPFDLLDAG
ADRIGEILGELLRLFDAGALEPLPVRAWDVRQARDALGWMSRARHIGKNVLTLPRPLDPE
GAVVLTGGSGTLAGILARHLRERHVYLLSRTAPPEGTPGVHLPCDVGDRDQLAAALERVD
RPITAVVHLAGALDDGTVASLTPERFDTVLRPKADGAWYLHELTKEQDLAAFVLYSSAAG
VLGNAGQGNYVAANAFLDALAELRHGSGLPALSIAWGLWEDVSGLTAALGEADRDRMRRS
GFRAITAQQGMHLYEAAGRTGSPVVVAAALDDAPDVPLLRGLRRTTVRRAAVRECSSADR
LAALTGDELAEALLTLVRESTAAVLGHVGGEDIPATAAFKDLGIDSLTAVQLRNALTEAT
GVRLNATAVFDFPTPHVLAGKLGDELTGTRAPVVPRTAATAGAHDEPLAIVGMACRLPGG
VASPEELWHLVASGTDAITEFPTDRGWDVDAIYDPDPDAIGKTFVRHGGFLTGATGFDAA
FFGISPREALAMDPQQRVLLETSWEAFESAGITPDSTRGSDTGVFVGAFSYGYGTGADTD
GFGATGSQTSVLSGRLSYFYGLEGPAVTVDTACSSSLVALHQAGQSLRSGECSLALVGGV
TVMASPGGFVEFSRQRGLAPDGRAKAFGAGADGTSFAEGAGVLIVERLSDAERNGHTVLA
VVRGSAVNQDGASNGLSAPNGPSQERVIRQALANAGLTPADVDAVEAHGTGTRLGDPIEA
QAVLATYGQERATPLLLGSLKSNIGHAQAASGVAGIIKMVQALRHGELPPTLHADEPSPH
VDWTAGAVELLTSARPWPETDRPRRAAVSSFGVSGTNAHVILEAGPVTETPAASPSGDLP
LLVSARSPEALDEQIRRLRAYLDTTPDVDRVAVAQTLARRTHFAHRAVLLGDTVITTPPA
DRPDELVFVYSGQGTQHPAMGEQLAAAHPVFADAWHEALRRLDNPDPHDPTHSQHVLFAH
QAAFTALLRSWGITPHAVIGHSLGEITAAHAAGILSLDDACTLITTRARLMHTLPPPGAM
VTVLTSEEKARQALRPGVEIAAVNGPHSIVLSGDEDAVLTVAGQLGIHHRLPAPHAGHSA
HMEPVAAELLATTRGLRYHPPHTSIPNDPTTAEYWAEQVRKPVLFHAHAQQYPDAVFVEI
GPAQDLSPLVDGIPLQNGTADEVHALHTALAHLYARGATLDWPRILGAGSRHDADVPAYA
FQRRHYWIESARPAASDAGHPVLGSGIALAGSPGRVFTGSVPTGADRAVFVAELALAAAD
AVDCATVERLDIASVPGRPGHGRTTVQTWVDEPADDGRRRFTVHTRTGDAPWTLHAEGVL
RPHGTALPDAADAEWPPPGAVPADGLPGVWRRGDQVFAEAEVDGPDGFVVHPDLLDAVFS
AVGDGSRQPAGWRDLTVHASDATVLRACLTRRTDGAMGFAAFDGAGLPVLTAEAVTLREV
ASPSGSEESDGLHRLEWLAVAEAVYDGDLPEGHVLITAAHPDDPEDIPTRAHTRATRVLT
ALQHHLTTTDHTLIVHTTTDPAGATVTGLTRTAQNEHPHRIRLIETDHPHTPLPLAQLAT
LDHPHLRLTHHTLHHPHLTPLHTTTPPTTTPLNPEHAIIITGGSGTLAGILARHLNHPHT
YLLSRTPPPDATPGTHLPCDVGDPHQLATTLTHIPQPLTAIFHTAATLDDGILHALTPDR
LTTVLHPKANAAWHLHHLTQNQPLTHFVLYSSAAAVLGSPGQGNYAAANAFLDALATHRH
TLGQPATSIAWGMWHTTSTLTGQLDDADRDRIRRGGFLPITDDEGMRLYEAAVGSGEDFV
MAAAMDPAQPMTGSVPPILSGLRRSARRVARAGQTFAQRLAELPDADRGAALTTLVSDAT
AAVLGHADASEIAPTTTFKDLGIDSLTAIELRNRLAEATGLRLSATLVFDHPTPRVLAAK
LRTDLFGTAVPTPARTARTHHDEPLAIVGMACRLPGGVASPEDLWQLVASGTDAITEFPT
DRGWDIDRLFDPDPDAPGKTYVRHGGFLAEAAGFDAAFFGISPREARAMDPQQRVILETS
WEAFENAGIVPDTLRGSDTGVFMGAFSHGYGAGVDLGGFGATATQNSVLSGRLSYFFGME
GPAVTVDTACSSSLVALHQAAQALRTGECSLALAGGVTVMPTPLGYVEFCRQRGLAPDGR
CQAFAEGADGTSFSEGAGVLVLERLSDAERNGHTVLAVVRSSAVNQDGASNGISAPNGPS
QQRVIRQALDKAGLAPADVDVVEAHGTGTPLGDPIEAQAIIATYGQDRDTPLYLGSVKSN
IGHTQTTAGVAGVIKMVMAMRHGIAPKTLHVDEPSSHVDWTEGAVELLTEARPWPDAGRP
RRAGVSSLGISGTNAHVILEGVPGPSRVEPSVDGLVPLPVSARSEASLRGQVERLEGYLR
GSVDVAAVAQGLVRERAVFGHRAVLLGDARVMGVAVDQPRTVFVFPGQGAQWVGMGVELM
DRSAVFAARMEECARALLPHTGWDVREMLARPDVAERVEVVQPASWAVAVSLAALWQAHG
VVPDAVIGHSQGEIAAACVAGALSLEDAARVVALRSQVIAARLAGRGAMASVALPAGEVG
LVEGVWIAARNGPASTVVAGEPSAVEDVVTRYETEGVRVRRIAVDYASHTPHVEAIEDEL
AEVLKGVAGKAASVAWWSTVDSAWVTEPVDESYWYRNLRRPVALDAAVAELDGSVFVECS
AHPVLLPAMEQAHTVASLRTGDGGWERWLTALAQAWTLGAAVDWDTVVEPVPGRLLDLPT
YAFERRRYWLEAAGATDLSAAGLTGAAHPMLAAITALPADDGGVVLTGRISLRTHPWLAD
HAVRGTVLLPGTAFVELVIRAGDETGCGIVDELVIESPLVVPATAAVDLSVTVEGADEAG
RRRVTVHARTEGTGSWTRHASGTLTPDTPDTPNASGVVGAEPFSQWPPATAAAVDTSEFY
LRLDALGYRFGPMFRGMRAAWRDGDTVYAEVALPEDRAADADGFGMHPALLDAALQSGSL
LMLESDGEQSVQLPFSWHGVRFHATGATMLRVAVVPGPDGLRLHAADSGNRPVATIDALV
TRSPEADLAPADPMLRVGWAPVPVPAGAGPSDADVLTLRGDDADPLGETRDLTTRVLDAL
LRADRPVIFQVTGGLAAKAAAGLVRTAQNEQPGRFFLVETDPGEVLDGAKRDAIAALGEP
HVRLRDGLFEAARLMRATPSLTLPDTGSWQLRPSATGSLDDLAVVPTDAPDRPLAAGEVR
IAVRAAGLNFRDVTVALGVVADARPLGSEAAGVVLETGPGVHDLAPGDRVLGMLAGAFGP
VAITDRRLLGRMPDGWTFPQAASVMTAFATAWYGLVDLAGLRPGEKVLIHAAATGVGAAA
VQIARHLGAEVYATTSAAKRHLVDLDGAHLADSRSTAFADAFPPVDVVLNSLTGEFLDAS
VGLLAAGGRFIEMGKTDIRHAVQQPFDLMDAGPDRMQRIIVELLGLFARDVLHPLPVHAW
DVRQAREAFGWMSSGRHTGKLVLTVPRPLDPEGAVVITGGSGTLAGILARHLGHPHTYLL
SRTPPPDTTPGTHLPCDVGDPHQLATTLARIPQPLTAVFHTAGTLDDALLDNLTPDRVDT
VLKPKADAAWHLHRLTRDTDLAAFVVYSAVAGLMGSPGQGNYVAANAFLDALAEHRRAQG
LPAQSLAWGMWADVSALTAKLTDADRQRIRRSGFPPLSAADGMRLFDAATRTPEPVVVAT
TVDLTQLDGAVAPLLRGLAAHRAGPARTVARNAGEEPLAVRLAGRTAAEQRRIMQEVVLR
HAAAVLAYGLGDRVAADRPFRELGFDSLTAVDLRNRLAAETGLRLPTTLVFSHPTAEALT
AHLLDLIDAPTARIAGESLPAVTAAPVAAARDQDEPIAIVAMACRLPGGVTSPEDLWRLV
ESGTDAITTPPDDRGWDVDALYDADPDAAGKAYNLRGGYLAGAAEFDAAFFDISPREALG
MDPQQRLLLETAWEAIERGRISPASLRGREVGVYVGAAAQGYGLGAEDTEGHAITGGSTS
LLSGRLAYVLGLEGPAVTVDTACSSSLVALHLACQGLRLGECELALAGGVSVLSSPAAFV
EFSRQRGLAADGRCKSFGAGADGTTWSEGVGVLVLERLSDAERLGHTVLAVVRGSAVTSD
GASNGLTAPNGLSQQRVIRKALAAAGLTGADVDVVEGHGTGTRLGDPVEADALLATYGQD
RPAPVWLGSLKSNIGHATAAAGVAGVIKMVQAIGAGTMPRTLHVEEPSPAVDWSTGQVSL
LGSNRPWPDDERPRRAAVSAFGLSGTNAHVILEQHRPAPVASQPPRPPREESQPLPWVLS
ARTPAALRAQAARLRDHLAAAPDADPLDIGYALATSRAQFAHRAAVVATTPDGFRAALDG
LADGAEAPGVVTGTAQERRVAFLFDGQGAQRAGMGRELHRRFPVFAAAWDEVSDAFGKHL
KHSPTDVYHGEHGALAHDTLYAQAGLFTLEVALLRLLEHWGVRPDVLVGHSVGEVTAAYA
AGVLTLADATELIVARGRALRALPPGAMLAVDGSPAEVGARTDLDIAAVNGPSAVVLAGS
PDDVAAFEREWSAAGRRTKRLDVGHAFHSRHVDGALDGFRTVLESLAFGAARLPVVSTTT
GRDAADDLITPAHWLRHARRPVLFSDAVRELADRGVTTFVAVGPSGSLASAAAESAGEDA
GTYHAVLRARTGEETAALTALAELHAHGVPVDLAAVLAGGRPVDLPVYAFQHRSYWLAPA
VAGAPATVADTGGPAESEPEDLTVAEIVRRRTAALLGVTDPADVDAEATFFALGFDSLAV
QRLRNQLASATGLDLPAAVLFDHDTPAALTAFLQDRIEAGQDRIEAGEDDDAPTVLSLLE
EMESLDAADIAATPAPERAAIADLLDKLAHTWKDYR
selected fasta
>polyketide synthase [FkbA]
ATGCCCGAGCAGGACAAGACAGTCGAGTACCTTCGCTGGGCGACCGCGGAACTCCAGAAG
ACCCGTGCGGAACTCGCCGCGCACAGCGAGCCGTTGGCGATCGTGGGGATGGCCTGCCGG
CTGCCCGGCGGGGTCGCGTCGCCGGAGGACCTGTGGCAGTTGCTGGAGTCCGGTGGCGAC
GGCATCACCGCGTTCCCCACGGACCGGGGCTGGGAGACCACCGCCGACGGTCGCGGCGGC
TTCCTCACCGGGGCGGCCGGCTTCGACGCGGCGTTCTTCGGCATCAGCCCGCGCGAGGCG
CTGGCGATGGACCCGCAGCAGCGCCTGGCCCTGGAGACCTCGTGGGAGGCGTTCGAGCAC
GCGGGCATCGATCCGCAGACGCTGCGGGGCAGTGACACGGGGGTGTTCCTCGGCGCGTTC
TTCCAGGGGTACGGCATCGGCGCCGACTTCGACGGTTACGGCACCACGAGCATTCACACG
AGCGTGCTCTCCGGCCGCCTCGCGTACTTCTACGGTCTGGAGGGTCCGGCGGTCACGGTC
GACACGGCGTGTTCGTCGTCGCTGGTGGCGCTGCACCAGGCCGGGCAGTCGCTGCGCTCC
GGCGAATGCTCGCTCGCCCTGGTCGGCGGCGTCACGGTGATGGCCTCGCCGGCGGGGTTC
GCGGACTTCTCCGAGCAGGGCGGCCTGGCCCCCGACGCGCGCTGCAAGGCCTTCGCGGAA
GCGGCTGACGGCACCGGTTTCGCCGAGGGGTCCGGCGTCCTGATCGTCGAGAAGCTCTCC
GACGCCGAGCGCAACGGCCACCGCGTGCTGGCGGTCGTCCGGGGTTCCGCCGTCAACCAG
GACGGTGCCTCCAACGGGCTGTCCGCGCCGAACGGGCCGTCGCAGGAGCGGGTGATCCGG
CAGGCCCTGGCCAACGCCGGACTCACCCCGGCGGACGTGGACGCCGTCGAGGCCCACGGC
ACCGGCACCAGGCTGGGCGACCCCATCGAGGCACAGGCCGTGCTGGCCACCTACGGGCAG
GGGCGCGACACCCCTGTGCTGCTGGGCTCGCTGAAGTCCAACATCGGCCACACCCAGGCC
GCCGCGGGCGTCGCCGGTGTCATCAAGATGGTCCTCGCCATGCGGCACGGCACCCTGCCC
CGCACCCTGCACGTGGACACGCCGTCCTCGCACGTCGACTGGACGGCCGGCGCCGTCGAA
CTCCTCACCGACGCCCGGCCCTGGCCCGAAACCGACCGCCCACGGCGCGCCGGTGTCTCC
TCCTTCGGCGTCAGCGGCACCAACGCCCACATCATCCTCGAAAGCCACCCCCGACCGGCC
CCCGAACCCGCCCCGGCACCCGACACCGGACCGCTGCCGCTGCTGCTCTCGGCCCGCACC
CCGCAGGCACTCGACGCACAGGTACACCGCCTGCGCGCGTTCCTCGACGACAACCCCGGC
GCGGACCGGGTCGCCGTCGCGCAGACACTCGCCCGGCGCACCCAGTTCGAGCACCGCGCC
GTGCTGCTCGGCGACACGCTCATCACCGTGAGCCCGAACGCCGGCCGCGGACCGGTGGTC
TTCGTCTACTCGGGGCAAAGCACGCTGCACCCGCACACCGGGCGGCAACTCGCGTCCACC
TACCCCGTGTTCGCCGAAGCGTGGCGCGAGGCCCTCGACCACCTCGACCCCACCCAGGGC
CCGGCCACGCACTTCGCCCACCAGACCGCGCTCACCGCGCTCCTGCGGTCCTGGGGCATC
ACCCCGCACGCGGTCATCGGCCACTCCCTCGGTGAGATCACCGCCGCGCACGCCGCCGGT
GTCCTGTCCCTGAGGGACGCGGGCGCGCTCCTCACCACCCGCACCCGCCTGATGGACCAA
CTGCCGTCGGGCGGCGCGATGGTCACCGTCCTGACCAGCGAGGAAAAGGCACGCCAGGTG
CTGCGGCCGGGCGTGGAGATCGCCGCCGTCAACGGCCCCCACTCCCTCGTGCTGTCCGGG
GACGAGGAAGCCGTACTCGAAGCCGCCCGGCAGCTCGGCATCCACCACCGCCTGCCGACC
CGCCACGCCGGCCACTCCGAGCGCATGCAGCCACTCGTCGCCCCCCTCCTCGACGTCGCC
CGGACCCTGACGTACCACCAGCCCCACACCGCCATCCCCGGCGACCCCACCACCGCCGAA
TACTGGGCGCACCAGGTCCGCGACCAAGTACGTTTCCAGGCGCACACCGAGCAGTACCCG
GGCGCGACGTTCCTCGAGATCGGCCCCAACCAGGACCTCTCGCCGCTCGTCGACGGCGTT
GCCGCCCAGACCGGTACGCCCGACGAGGTGCGGGCGCTGCACACCGCGCTCGCGCAGCTC
CACGTCCGCGGCGTCGCGATCGACTGGACGCTCGTCCTCGGCGGGGACCGCGCGCCCGTC
ACGCTGCCCACGTATCCGTTCCAGCACAAGGACTACTGGCTGCGGCCCACCTCCCGGGCC
GATGTGACCGGCGCGGGGCAGGAGCAGGTGGCGCACCCGCTGCTCGGCGCCGCGGTCGCG
CTGCCCGGCACGGGCGGAGTCGTCCTGACCGGCCGCCTGTCGCTGGCCTCCCATCCGTGG
CTCGGCGAGCACGCGGTCGACGGCACCGTGCTCCTGCCCGGCGCGGCCTTCCTCGAACTC
GCGGCGCGCGCCGGCGACGAGGTCGGCTGCGACCTGCTGCACGAACTCGTCATCGAGACG
CCGCTCGTGCTGCCCGCGACCGGCGGTGTGGCGGTCTCCGTCGAGATCGCCGAACCCGAC
GACACGGGGCGGCGGGCGGTCACCGTCCACGCGCGGGCCGACGGCTCGGGCCTGTGGACC
CGACACGCCGGCGGATTCCTCGGCACGGCACCGGCACCGGCCACGGCCACGGACCCGGCA
CCCTGGCCGCCCGCGGAAGCCGGACCGGTCGACGTCGCCGACGTCTACGACCGGTTCGAG
GACATCGGGTACTCCTACGGACCGGGCTTCCGGGGGCTGCGGGCCGCCTGGCGCGCCGGC
GACACCGTGTACGCCGAGGTCGCGCTCCCCGACGAGCAGAGCGCCGACGCCGCCCGTTTC
ACGCTGCACCCCGCGCTGCTCGACGCCGCGTTCCAGGCCGGCGCGCTGGCCGCGCTCGAC
GCACCCGGCGGGGCGGCCCGACTGCCGTTCTCGTTCCAGGACGTCCGCATCCACGCGGCC
GGGGCGACGCGGCTGCGGGTCACGGTCGGCCGCGACGGCGAGCGCAGCACCGTCCGCATG
ACCGGCCCGGACGGGCAGCTGGTGGCCGTGGTCGGTGCCGTGCTGTCGCGCCCGTACGCG
GAAGGCTCCGGTGACGGCCTGCTGCGCCCGGTCTGGACCGAGCTGCCGATGCCCGTCCCG
TCCGCGGACGATCCGCGCGTGGAGGTCCTCGGCGCCGACCCGGGCGACGGCGACGTTCCG
GCGGCCACCCGGGAGCTGACCGCCCGCGTCCTCGGCGCGCTCCAGCGCCACCTGTCCGCC
GCCGAGGACACCACCTTGGTGGTACGGACCGGCACCGGCCCGGCCGCTGCCGCCGCCGCG
GGTCTGGTCCGCTCGGCGCAGGCGGAGAACCCCGGCCGCGTCGTGCTCGTCGAGGCGTCC
CCGGACACCTCGGTGGAGCTGCTCGCCGCGTGCGCCGCGCTGGACGAACCGCAGCTGGCC
GTCCGGGACGGCGTGCTCTTCGCGCCGCGGCTGGTCCGGATGTCCGACCCCGCGCACGGC
CCGCTGTCCCTGCCGGACGGCGACTGGCTGCTCACCCGGTCCGCCTCCGGCACGTTGCAC
GACGTCGCGCTCATAGCCGACGACACGCCCCGGCGGGCGCTCGAAGCCGGCGAGGTCCGC
ATCGACGTCCGCGCGGCCGGACTGAACTTCCGCGATGTGCTGATCGCGCTCGGGACGTAC
ACCGGGGCCACGGCCATGGGCGGCGAGGCCGCGGGCGTCGTGGTGGAGACCGGGCCCGGC
GTGGACGACCTGTCCCCCGGCGACCGGGTGTTCGGCCTGACCCGGGGCGGCATCGGCCCG
ACGGCCGTCACCGACCGGCGCTGGCTGGCCCGGATCCCCGACGGCTGGAGCTTCACCACG
GCGGCGTCCGTCCCGATCGTGTTCGCGACCGCGTGGTACGGCCTGGTCGACCTCGGCACA
CTGCGCGCCGGCGAGAAGGTCCTCGTCCACGCGGCCACCGGCGGTGTCGGCATGGCCGCC
GCACAGATCGCCCGCCACCTGGGCGCCGAGCTCTACGCCACCGCCAGTACCGGCAAGCAG
CACGTCCTGCGCGCCGCCGGGCTGCCCGACACGCACATCGCCGACTCTCGGACGACCGCG
TTCCGGACCGCTTTCCCGCGCATGGACGTCGTCCTGAACGCGCTGACCGGCGAGTTCATC
GACGCGTCGCTCGACCTGCTGGACGCCGACGGCCGGTTCGTCGAGATGGGCCGCACCGAG
CTGCGCGACCCGGCCGCGATCGTCCCCGCCTACCTGCCGTTCGACCTGCTGGACGCGGGC
GCCGACCGCATCGGCGAGATCCTGGGCGAACTGCTCCGGCTGTTCGACGCGGGCGCGCTG
GAGCCGCTGCCGGTCCGTGCCTGGGACGTCCGGCAGGCACGCGACGCGCTCGGCTGGATG
AGCCGCGCCCGCCACATCGGCAAGAACGTCCTGACGCTGCCCCGGCCGCTCGACCCGGAG
GGCGCCGTCGTCCTCACCGGCGGCTCCGGCACGCTCGCCGGCATCCTCGCCCGCCACCTG
CGCGAACGGCATGTCTACCTGCTGTCCCGGACGGCACCGCCCGAGGGGACGCCCGGCGTC
CACCTGCCCTGCGACGTCGGTGACCGGGACCAGCTGGCGGCGGCCCTGGAGCGGGTGGAC
CGGCCGATCACCGCCGTGGTGCACCTCGCCGGTGCGCTGGACGACGGCACCGTCGCGTCG
CTCACCCCCGAGCGTTTCGACACGGTGCTGCGCCCGAAGGCCGACGGCGCCTGGTACCTG
CACGAGCTGACGAAGGAGCAGGACCTCGCCGCGTTCGTGCTCTACTCGTCGGCCGCCGGC
GTGCTCGGCAACGCCGGCCAGGGCAACTACGTCGCCGCGAACGCGTTCCTCGACGCGCTC
GCCGAGCTGCGCCACGGTTCCGGGCTGCCGGCCCTCTCCATCGCCTGGGGGCTCTGGGAG
GACGTGAGCGGGCTCACCGCGGCGCTCGGCGAAGCCGACCGGGACCGGATGCGGCGCAGC
GGTTTCCGGGCCATCACCGCGCAACAGGGCATGCACCTGTACGAGGCGGCCGGCCGCACC
GGAAGTCCCGTGGTGGTCGCGGCGGCGCTCGACGACGCGCCGGACGTGCCGCTGCTGCGC
GGCCTGCGGCGGACGACCGTCCGGCGGGCCGCCGTCCGGGAGTGTTCGTCCGCCGACCGG
CTCGCCGCGCTGACCGGCGACGAGCTCGCCGAAGCGCTGCTGACGCTCGTCCGGGAGAGC
ACCGCCGCCGTGCTCGGCCACGTGGGTGGCGAGGACATCCCCGCGACGGCGGCGTTCAAG
GACCTCGGCATCGACTCGCTCACCGCGGTCCAGCTGCGCAACGCCCTCACCGAGGCGACC
GGTGTGCGGCTGAACGCCACGGCGGTCTTCGACTTCCCGACCCCGCACGTGCTCGCCGGG
AAGCTCGGCGACGAACTGACCGGCACCCGCGCGCCCGTCGTGCCCCGGACCGCGGCCACG
GCCGGTGCGCACGACGAGCCGCTGGCGATCGTGGGAATGGCCTGCCGGCTGCCCGGCGGG
GTCGCGTCACCCGAGGAGCTGTGGCACCTCGTGGCATCCGGCACCGACGCCATCACGGAG
TTCCCGACGGACCGCGGCTGGGACGTCGACGCGATCTACGACCCGGACCCCGACGCGATC
GGCAAGACCTTCGTCCGGCACGGTGGCTTCCTCACCGGCGCGACAGGCTTCGACGCGGCG
TTCTTCGGCATCAGCCCGCGCGAGGCCCTCGCGATGGACCCGCAGCAGCGGGTGCTCCTG
GAGACGTCGTGGGAGGCGTTCGAAAGCGCCGGCATCACCCCGGACTCGACCCGCGGCAGC
GACACCGGCGTGTTCGTCGGCGCCTTCTCCTACGGTTACGGCACCGGTGCGGACACCGAC
GGCTTCGGCGCGACCGGCTCGCAGACCAGTGTGCTCTCCGGCCGGCTGTCGTACTTCTAC
GGTCTGGAGGGTCCGGCGGTCACGGTCGACACGGCGTGTTCGTCGTCGCTGGTGGCGCTG
CACCAGGCCGGGCAGTCGCTGCGCTCCGGCGAATGCTCGCTCGCCCTGGTCGGCGGCGTC
ACGGTGATGGCGTCTCCCGGCGGCTTCGTGGAGTTCTCCCGGCAGCGCGGCCTCGCGCCG
GACGGCCGGGCGAAGGCGTTCGGCGCGGGTGCGGACGGCACGAGCTTCGCCGAGGGTGCC
GGTGTGCTGATCGTCGAGAGGCTCTCCGACGCCGAACGCAACGGTCACACCGTCCTGGCG
GTCGTCCGTGGTTCGGCGGTCAACCAGGATGGTGCCTCCAACGGGCTGTCGGCGCCGAAC
GGGCCGTCGCAGGAGCGGGTGATCCGGCAGGCCCTGGCCAACGCCGGGCTCACCCCGGCG
GACGTGGACGCCGTCGAGGCCCACGGCACCGGCACCAGGCTGGGCGACCCCATCGAGGCA
CAGGCGGTACTGGCCACCTACGGACAGGAGCGCGCCACCCCCCTGCTGCTGGGCTCGCTG
AAGTCCAACATCGGCCACGCCCAGGCCGCGTCCGGCGTCGCCGGCATCATCAAGATGGTG
CAGGCCCTCCGGCACGGGGAGCTGCCGCCGACGCTGCACGCCGACGAGCCGTCGCCGCAC
GTCGACTGGACGGCCGGCGCCGTCGAACTGCTGACGTCGGCCCGGCCGTGGCCCGAGACC
GACCGGCCACGGCGTGCCGCCGTCTCCTCGTTCGGGGTGAGCGGCACCAACGCCCACGTC
ATCCTGGAGGCCGGACCGGTAACGGAGACGCCCGCGGCATCGCCTTCCGGTGACCTTCCC
CTGCTGGTGTCGGCACGCTCACCGGAAGCGCTCGACGAGCAGATCCGCCGACTGCGCGCC
TACCTGGACACCACCCCGGACGTCGACCGGGTGGCCGTGGCACAGACGCTGGCCCGGCGC
ACACACTTCGCCCACCGCGCCGTGCTGCTCGGTGACACCGTCATCACCACACCCCCCGCG
GACCGGCCCGACGAACTCGTCTTCGTCTACTCCGGCCAGGGCACCCAGCATCCCGCGATG
GGCGAGCAGCTCGCCGCCGCCCATCCCGTGTTCGCCGACGCCTGGCATGAAGCGCTCCGC
CGCCTTGACAACCCCGACCCCCACGACCCCACGCACAGCCAGCATGTGCTCTTCGCCCAC
CAGGCGGCGTTCACCGCCCTCCTGCGGTCCTGGGGCATCACCCCGCACGCGGTCATCGGC
CACTCGCTGGGCGAGATCACCGCGGCGCACGCCGCCGGCATCCTGTCGCTGGACGACGCG
TGCACCCTGATCACCACGCGCGCCCGCCTCATGCACACGCTCCCGCCACCCGGTGCCATG
GTCACCGTACTGACCAGCGAAGAGAAGGCACGCCAGGCGTTGCGGCCGGGCGTGGAGATC
GCCGCCGTCAACGGGCCCCACTCCATCGTGCTGTCCGGGGACGAGGACGCCGTGCTCACC
GTCGCCGGGCAGCTCGGCATCCACCACCGCCTGCCCGCCCCGCACGCCGGGCACTCCGCG
CACATGGAGCCCGTGGCCGCCGAGCTGCTCGCCACCACCCGCGGGCTCCGCTACCACCCT
CCCCACACCTCCATTCCGAACGACCCCACCACCGCTGAGTACTGGGCCGAGCAGGTCCGC
AAGCCCGTGCTGTTCCACGCCCACGCGCAGCAGTACCCGGACGCCGTGTTCGTGGAGATC
GGCCCCGCCCAGGACCTCTCCCCGCTCGTCGACGGGATCCCGCTGCAGAACGGCACCGCG
GACGAGGTGCACGCGCTGCACACCGCGCTCGCGCACCTCTACGCGCGCGGTGCCACGCTC
GACTGGCCCCGCATCCTCGGGGCTGGGTCACGGCACGACGCGGATGTGCCCGCGTACGCG
TTCCAACGGCGGCACTACTGGATCGAGTCGGCACGCCCGGCCGCATCCGACGCGGGCCAC
CCCGTGCTGGGCTCCGGTATCGCCCTCGCCGGGTCGCCGGGCCGGGTGTTCACGGGTTCC
GTGCCGACCGGTGCGGACCGCGCGGTGTTCGTCGCCGAGCTGGCGCTGGCCGCCGCGGAC
GCGGTCGACTGCGCCACGGTCGAGCGGCTCGACATCGCCTCCGTGCCCGGCCGGCCGGGC
CATGGCCGGACGACCGTACAGACCTGGGTCGACGAGCCGGCGGACGACGGCCGGCGCCGG
TTCACCGTGCACACCCGCACCGGCGACGCCCCGTGGACGCTGCACGCCGAGGGGGTGCTG
CGCCCCCATGGCACGGCCCTGCCCGATGCGGCCGACGCCGAGTGGCCCCCACCGGGCGCG
GTGCCCGCGGACGGGCTGCCGGGTGTGTGGCGCCGGGGGGACCAGGTCTTCGCCGAGGCC
GAGGTGGACGGACCGGACGGTTTCGTGGTGCACCCCGACCTGCTCGACGCGGTCTTCTCC
GCGGTCGGCGACGGAAGCCGCCAGCCGGCCGGATGGCGCGACCTGACGGTGCACGCGTCG
GACGCCACCGTACTGCGCGCCTGCCTCACCCGGCGCACCGACGGAGCCATGGGATTCGCC
GCCTTCGACGGCGCCGGCCTGCCGGTACTCACCGCGGAGGCGGTGACGCTGCGGGAGGTG
GCGTCACCGTCCGGCTCCGAGGAGTCGGACGGCCTGCACCGGTTGGAGTGGCTCGCGGTC
GCCGAGGCGGTCTACGACGGTGACCTGCCCGAGGGACATGTCCTGATCACCGCCGCCCAC
CCCGACGACCCCGAGGACATACCCACCCGCGCCCACACCCGCGCCACCCGCGTCCTGACC
GCCCTGCAACACCACCTCACCACCACCGACCACACCCTCATCGTCCACACCACCACCGAC
CCCGCCGGCGCCACCGTCACCGGCCTCACCCGCACCGCCCAGAACGAACACCCCCACCGC
ATCCGCCTCATCGAAACCGACCACCCCCACACCCCCCTCCCCCTGGCCCAACTCGCCACC
CTCGACCACCCCCACCTCCGCCTCACCCACCACACCCTCCACCACCCCCACCTCACCCCC
CTCCACACCACCACCCCACCCACCACCACCCCCCTCAACCCCGAACACGCCATCATCATC
ACCGGCGGCTCCGGCACCCTCGCCGGCATCCTCGCCCGCCACCTGAACCACCCCCACACC
TACCTCCTCTCCCGCACCCCACCCCCCGACGCCACCCCCGGCACCCACCTCCCCTGCGAC
GTCGGCGACCCCCACCAACTCGCCACCACCCTCACCCACATCCCCCAACCCCTCACCGCC
ATCTTCCACACCGCCGCCACCCTCGACGACGGCATCCTCCACGCCCTCACCCCCGACCGC
CTCACCACCGTCCTCCACCCCAAAGCCAACGCCGCCTGGCACCTGCACCACCTCACCCAA
AACCAACCCCTCACCCACTTCGTCCTCTACTCCAGCGCCGCCGCCGTCCTCGGCAGCCCC
GGACAAGGAAACTACGCCGCCGCCAACGCCTTCCTCGACGCCCTCGCCACCCACCGCCAC
ACCCTCGGCCAACCCGCCACCTCCATCGCCTGGGGCATGTGGCACACCACCAGCACCCTC
ACCGGACAACTCGACGACGCCGACCGGGACCGCATCCGCCGCGGCGGTTTCCTCCCGATC
ACGGACGACGAGGGCATGCGCCTCTACGAGGCGGCCGTCGGCTCCGGCGAGGACTTCGTC
ATGGCCGCCGCGATGGACCCGGCACAGCCGATGACCGGCTCCGTACCGCCCATCCTGAGC
GGCCTGCGCAGGAGCGCGCGGCGCGTCGCCCGTGCCGGGCAGACGTTCGCCCAGCGGCTC
GCCGAGCTGCCCGACGCCGACCGCGGCGCGGCGCTGACCACCCTCGTCTCGGACGCCACG
GCCGCCGTGCTCGGCCACGCCGACGCCTCCGAGATCGCGCCGACCACGACGTTCAAGGAC
CTCGGCATCGACTCGCTCACCGCGATCGAGCTGCGCAACCGGCTCGCGGAGGCGACCGGG
CTGCGGCTGAGTGCCACGCTGGTGTTCGACCACCCGACACCTCGGGTCCTCGCCGCCAAG
CTCCGCACCGATCTGTTCGGCACGGCCGTGCCCACGCCCGCGCGGACGGCACGGACCCAC
CACGACGAGCCACTCGCGATCGTCGGCATGGCGTGCCGACTGCCCGGCGGGGTCGCCTCG
CCGGAGGACCTGTGGCAGCTCGTGGCGTCCGGCACCGACGCGATCACCGAGTTCCCCACC
GACCGCGGCTGGGACATCGACCGGCTGTTCGACCCGGACCCGGACGCCCCCGGCAAGACC
TACGTCCGGCACGGCGGCTTCCTCGCCGAGGCCGCCGGCTTCGATGCCGCGTTCTTCGGC
ATCAGCCCGCGCGAGGCACGGGCCATGGACCCGCAGCAGCGCGTCATCCTCGAAACCTCC
TGGGAGGCGTTCGAGAACGCGGGCATCGTGCCGGACACGCTGCGCGGCAGCGACACCGGC
GTGTTCATGGGCGCGTTCTCCCATGGGTACGGCGCCGGCGTCGACCTGGGCGGGTTCGGC
GCCACCGCCACGCAGAACAGCGTGCTCTCCGGCCGGTTGTCGTACTTCTTCGGCATGGAG
GGCCCGGCCGTCACCGTCGACACCGCCTGCTCGTCGTCGCTGGTCGCCCTGCACCAGGCG
GCACAGGCGCTGCGGACTGGAGAATGCTCGCTGGCGCTCGCCGGCGGTGTCACGGTGATG
CCCACCCCGCTGGGCTACGTCGAGTTCTGCCGCCAGCGGGGACTCGCCCCCGACGGCCGT
TGCCAGGCCTTCGCGGAAGGCGCCGACGGCACGAGCTTCTCGGAGGGCGCCGGCGTTCTT
GTGCTGGAGCGGCTCTCCGACGCCGAGCGCAACGGACACACCGTCCTCGCGGTCGTCCGC
TCCTCCGCCGTCAACCAGGACGGCGCCTCCAACGGCATCTCCGCACCCAACGGCCCCTCC
CAGCAGCGCGTCATCCGCCAGGCCCTCGACAAGGCCGGGCTCGCCCCCGCCGACGTGGAC
GTGGTGGAGGCCCACGGCACCGGAACCCCGCTGGGCGACCCGATCGAGGCACAGGCCATC
ATCGCGACCTACGGCCAGGACCGCGACACACCGCTCTACCTCGGTTCGGTCAAGTCGAAC
ATCGGACACACCCAGACCACCGCCGGTGTCGCCGGCGTCATCAAGATGGTCATGGCGATG
CGCCACGGCATCGCGCCGAAGACACTGCACGTGGACGAGCCGTCGTCGCATGTGGACTGG
ACCGAGGGTGCGGTGGAACTGCTCACCGAGGCGAGGCCGTGGCCCGACGCGGGACGCCCG
CGCCGCGCGGGCGTGTCGTCGCTCGGTATCAGCGGTACGAACGCCCACGTGATCCTTGAG
GGTGTTCCCGGGCCGTCGCGTGTGGAGCCGTCTGTTGACGGGTTGGTGCCGTTGCCGGTG
TCGGCTCGGAGTGAGGCGAGTCTGCGGGGGCAGGTGGAGCGGCTGGAGGGGTATCTGCGC
GGGAGTGTGGATGTGGCCGCGGTCGCGCAGGGGTTGGTGCGTGAGCGTGCTGTCTTCGGT
CACCGTGCGGTACTGCTGGGTGATGCCCGGGTGATGGGTGTGGCGGTGGATCAGCCGCGT
ACGGTGTTCGTCTTTCCCGGGCAGGGTGCTCAGTGGGTGGGCATGGGTGTGGAGTTGATG
GACCGTTCTGCGGTGTTCGCGGCTCGTATGGAGGAGTGTGCGCGGGCGTTGTTGCCGCAC
ACGGGCTGGGATGTGCGGGAGATGTTGGCGCGGCCGGATGTGGCGGAGCGGGTGGAGGTG
GTCCAGCCGGCCAGCTGGGCGGTCGCGGTCAGCCTGGCCGCACTGTGGCAGGCCCACGGG
GTCGTACCCGACGCGGTGATCGGACACTCCCAGGGCGAGATCGCGGCGGCGTGCGTGGCC
GGGGCCCTCAGCCTTGAGGACGCCGCCCGCGTGGTGGCCTTGCGCAGCCAGGTCATCGCG
GCGCGACTGGCCGGGCGGGGAGCGATGGCTTCGGTGGCATTGCCGGCCGGTGAGGTCGGT
CTGGTCGAGGGCGTGTGGATCGCGGCGCGTAACGGCCCCGCCTCGACAGTCGTGGCCGGC
GAGCCGTCGGCGGTGGAGGACGTGGTGACGCGGTATGAGACCGAAGGCGTGCGAGTGCGT
CGTATCGCCGTCGACTACGCCTCCCACACGCCCCACGTGGAAGCCATCGAGGACGAACTC
GCTGAGGTACTGAAGGGAGTTGCAGGGAAGGCCGCGTCGGTGGCGTGGTGGTCGACCGTG
GACAGCGCCTGGGTGACCGAGCCGGTGGATGAGAGTTACTGGTACCGGAACCTGCGTCGC
CCCGTCGCGCTGGACGCGGCGGTGGCGGAGCTGGACGGGTCCGTGTTCGTGGAGTGCAGC
GCCCATCCGGTGCTGCTGCCGGCGATGGAACAGGCCCACACGGTGGCGTCGTTGCGCACC
GGTGACGGCGGCTGGGAGCGATGGCTGACGGCGTTGGCGCAGGCGTGGACCCTGGGCGCG
GCAGTGGACTGGGACACGGTGGTCGAACCGGTGCCAGGGCGGCTGCTCGATCTGCCCACC
TACGCGTTCGAGCGCCGGCGCTACTGGCTGGAAGCGGCCGGTGCCACCGACCTGTCCGCG
GCCGGGCTGACAGGGGCAGCACATCCCATGCTGGCCGCCATCACGGCACTACCCGCCGAC
GACGGTGGTGTTGTTCTCACCGGCCGGATCTCGTTGCGCACGCATCCCTGGCTGGCTGAT
CACGCGGTGCGGGGCACGGTCCTGCTGCCGGGCACGGCCTTTGTGGAGCTGGTCATCCGG
GCCGGTGACGAGACCGGTTGCGGGATAGTGGATGAACTGGTCATCGAATCCCCCCTCGTG
GTGCCGGCGACCGCAGCCGTGGATCTGTCGGTGACCGTGGAAGGAGCTGACGAGGCCGGA
CGGCGGCGAGTGACCGTCCACGCCCGCACCGAAGGCACCGGCAGCTGGACCCGGCACGCC
AGCGGCACCCTGACCCCCGACACCCCCGACACCCCCAACGCTTCCGGTGTTGTCGGTGCG
GAGCCGTTCTCGCAGTGGCCACCTGCCACTGCCGCGGCCGTCGACACCTCGGAGTTCTAC
TTGCGCCTGGACGCGCTGGGCTACCGGTTCGGACCCATGTTCCGCGGAATGCGGGCTGCC
TGGCGTGATGGTGACACCGTGTACGCCGAGGTCGCGCTCCCCGAGGACCGTGCCGCCGAC
GCGGACGGTTTCGGCATGCACCCGGCGCTGCTCGACGCGGCCTTGCAGAGCGGCAGCCTG
CTCATGCTGGAATCGGACGGCGAGCAGAGCGTGCAACTGCCGTTCTCCTGGCACGGCGTC
CGGTTCCACGCGACGGGCGCGACCATGCTGCGGGTGGCGGTCGTACCGGGCCCGGACGGC
CTCCGGCTGCATGCCGCGGACAGCGGGAACCGTCCCGTCGCGACGATCGACGCGCTCGTG
ACCCGGTCCCCGGAAGCGGACCTCGCGCCCGCCGATCCGATGCTGCGGGTCGGGTGGGCC
CCGGTGCCCGTACCTGCCGGGGCCGGTCCGTCCGACGCGGACGTGCTGACGCTGCGCGGC
GACGACGCCGACCCGCTCGGGGAGACCCGGGACCTGACCACCCGTGTTCTCGACGCGCTG
CTCCGGGCCGACCGGCCGGTGATCTTCCAGGTGACCGGTGGCCTCGCCGCCAAGGCGGCC
GCAGGCCTGGTCCGCACCGCTCAGAACGAGCAGCCCGGCCGCTTCTTCCTCGTCGAAACG
GACCCGGGAGAGGTCCTGGACGGCGCGAAGCGCGACGCGATCGCGGCACTCGGCGAGCCC
CATGTGCGGCTGCGCGACGGCCTCTTCGAGGCAGCCCGGCTGATGCGGGCCACGCCGTCC
CTGACGCTCCCGGACACCGGGTCGTGGCAGCTGCGGCCGTCCGCCACCGGTTCCCTCGAC
GACCTTGCCGTCGTCCCCACCGACGCCCCGGACCGGCCGCTCGCGGCCGGCGAGGTGCGG
ATCGCGGTACGCGCGGCGGGCCTGAACTTCCGGGATGTCACGGTCGCGCTCGGTGTGGTC
GCCGATGCGCGTCCGCTCGGCAGCGAGGCCGCGGGTGTCGTCCTGGAGACCGGCCCCGGT
GTGCACGACCTGGCGCCCGGCGACCGGGTCCTGGGGATGCTCGCGGGCGCCTTCGGACCG
GTCGCGATCACCGACCGGCGGCTGCTCGGCCGGATGCCGGACGGCTGGACGTTCCCGCAG
GCGGCGTCCGTGATGACCGCGTTCGCGACCGCGTGGTACGGCCTGGTCGACCTGGCCGGG
CTGCGCCCCGGCGAGAAGGTCCTGATCCACGCGGCGGCGACCGGTGTCGGCGCGGCGGCC
GTCCAGATCGCGCGGCATCTGGGCGCGGAGGTGTACGCGACCACCAGCGCCGCGAAGCGC
CATCTGGTGGACCTGGACGGAGCGCATCTGGCCGATTCCCGCAGCACCGCGTTCGCCGAC
GCGTTCCCGCCGGTCGATGTCGTGCTCAACTCGCTCACCGGTGAATTCCTCGACGCGTCC
GTCGGCCTGCTCGCGGCGGGTGGCCGGTTCATCGAGATGGGGAAGACGGACATCCGGCAC
GCCGTCCAGCAGCCGTTCGACCTGATGGACGCCGGCCCCGACCGGATGCAGCGGATCATC
GTCGAGCTGCTCGGCCTGTTCGCGCGCGACGTGCTGCACCCGCTGCCGGTCCACGCCTGG
GACGTGCGGCAGGCGCGGGAGGCGTTCGGCTGGATGAGCAGCGGGCGTCACACCGGCAAG
CTGGTGCTGACGGTCCCGCGGCCGCTGGATCCCGAGGGGGCCGTCGTCATCACCGGCGGC
TCCGGCACCCTCGCCGGCATCCTCGCCCGCCACCTGGGCCACCCCCACACCTACCTGCTC
TCCCGCACCCCACCCCCCGACACCACCCCCGGCACCCACCTCCCCTGCGACGTCGGCGAC
CCCCACCAACTCGCCACCACCCTCGCCCGCATCCCCCAACCCCTCACCGCCGTCTTCCAC
ACCGCCGGAACCCTCGACGACGCCCTGCTCGACAACCTCACCCCCGACCGCGTCGACACC
GTCCTCAAACCCAAGGCCGACGCCGCCTGGCACCTGCACCGGCTCACCCGCGACACCGAC
CTCGCCGCGTTCGTCGTCTACTCCGCGGTCGCCGGCCTCATGGGCAGCCCGGGGCAGGGC
AACTACGTCGCGGCGAACGCGTTCCTCGACGCGCTCGCCGAACACCGCCGTGCGCAAGGG
CTGCCCGCGCAGTCCCTCGCATGGGGCATGTGGGCGGACGTCAGCGCGCTCACCGCGAAA
CTCACCGACGCGGACCGCCAGCGCATCCGGCGCAGCGGATTCCCGCCGTTGAGCGCCGCG
GACGGCATGCGGCTGTTCGACGCGGCGACGCGTACCCCGGAACCGGTCGTCGTCGCGACG
ACCGTCGACCTCACCCAGCTCGACGGCGCCGTCGCGCCGTTGCTCCGCGGTCTGGCCGCG
CACCGGGCCGGGCCGGCGCGCACGGTCGCCCGCAACGCCGGCGAAGAGCCCCTGGCCGTG
CGTCTTGCCGGGCGTACCGCCGCCGAGCAGCGGCGCATCATGCAGGAGGTCGTGCTCCGC
CACGCGGCCGCGGTCCTCGCGTACGGGCTGGGCGACCGCGTGGCGGCGGACCGTCCGTTC
CGCGAGCTCGGTTTCGATTCGCTGACCGCGGTCGACCTGCGCAATCGGCTCGCGGCCGAG
ACGGGGCTGCGGCTGCCGACGACGCTGGTGTTCAGCCACCCGACGGCGGAGGCGCTCACC
GCCCACCTGCTCGACCTGATCGACGCTCCCACCGCCCGGATCGCCGGGGAGTCCCTGCCC
GCGGTGACGGCCGCTCCCGTGGCGGCCGCGCGGGACCAGGACGAGCCGATCGCCATCGTG
GCGATGGCGTGCCGGCTGCCCGGTGGTGTGACGTCGCCCGAGGACCTGTGGCGGCTCGTC
GAGTCCGGCACCGACGCGATCACCACGCCTCCTGACGACCGCGGCTGGGACGTCGACGCG
CTGTACGACGCGGACCCGGACGCGGCCGGCAAGGCGTACAACCTGCGGGGCGGTTACCTG
GCCGGGGCGGCGGAGTTCGACGCGGCGTTCTTCGACATCAGTCCGCGCGAAGCGCTCGGC
ATGGACCCGCAGCAACGCCTGCTGCTCGAAACGGCGTGGGAGGCGATCGAGCGCGGCCGG
ATCAGTCCGGCGTCGCTCCGCGGCCGGGAGGTCGGCGTCTATGTCGGTGCGGCCGCGCAG
GGCTACGGGCTGGGCGCCGAGGACACCGAGGGCCACGCGATCACCGGTGGTTCCACGAGC
CTGCTGTCCGGACGGCTGGCGTACGTGCTCGGGCTGGAGGGCCCGGCGGTCACCGTGGAC
ACGGCGTGCTCGTCGTCTCTGGTCGCGCTGCATCTGGCGTGCCAGGGGCTGCGCCTGGGC
GAGTGCGAACTCGCTCTGGCCGGAGGGGTCTCCGTACTGAGTTCGCCGGCCGCGTTCGTG
GAGTTCTCCCGCCAGCGCGGGCTCGCGGCCGACGGGCGCTGCAAGTCGTTCGGCGCGGGC
GCGGACGGCACGACGTGGTCCGAGGGCGTGGGCGTGCTCGTACTGGAACGGCTCTCCGAC
GCCGAGCGGCTCGGGCACACCGTGCTCGCCGTCGTCCGCGGCAGCGCCGTCACGTCCGAC
GGCGCCTCCAACGGCCTCACCGCGCCGAACGGGCTCTCGCAGCAGCGGGTCATCCGGAAG
GCGCTCGCCGCGGCCGGGCTGACCGGCGCCGACGTGGACGTCGTCGAGGGGCACGGCACC
GGCACCCGGCTCGGCGACCCGGTCGAGGCGGACGCGCTGCTCGCGACGTACGGGCAGGAC
CGTCCGGCACCGGTCTGGCTGGGCTCGCTGAAGTCGAACATCGGACATGCCACGGCCGCG
GCCGGTGTCGCGGGCGTCATCAAGATGGTGCAGGCGATCGGCGCGGGCACGATGCCGCGG
ACGCTGCATGTGGAGGAGCCCTCGCCCGCCGTCGACTGGAGCACCGGACAGGTGTCCCTG
CTCGGCTCCAACCGGCCCTGGCCGGACGACGAGCGTCCGCGCCGGGCGGCCGTCTCCGCG
TTCGGGCTCAGCGGGACGAACGCGCACGTCATCCTGGAACAGCACCGTCCGGCGCCCGTG
GCGTCCCAGCCGCCCCGGCCGCCCCGTGAGGAGTCCCAGCCGCTGCCGTGGGTGCTCTCC
GCGCGGACTCCGGCCGCGCTGCGGGCCCAGGCGGCCCGGCTGCGCGACCACCTCGCGGCG
GCACCGGACGCGGATCCGTTGGACATCGGGTACGCGCTGGCCACCAGCCGCGCCCAGTTC
GCCCACCGTGCCGCGGTCGTCGCCACCACCCCGGACGGATTCCGTGCCGCGCTCGACGGC
CTCGCGGACGGCGCGGAGGCGCCCGGAGTCGTCACCGGGACCGCTCAGGAGCGGCGCGTC
GCCTTCCTCTTCGACGGCCAGGGCGCCCAGCGCGCCGGAATGGGGCGCGAGCTCCACCGC
CGGTTCCCCGTCTTCGCCGCCGCGTGGGACGAGGTCTCCGACGCGTTCGGCAAGCACCTC
AAGCACTCCCCCACGGACGTCTACCACGGCGAACACGGCGCTCTCGCCCATGACACCCTG
TACGCCCAGGCCGGCCTGTTCACGCTCGAAGTGGCGCTGCTGCGGCTGCTGGAGCACTGG
GGGGTGCGGCCGGACGTGCTCGTCGGGCACTCCGTCGGCGAGGTGACCGCGGCGTACGCG
GCGGGGGTGCTCACCCTGGCGGACGCGACGGAGTTGATCGTGGCCCGGGGGCGGGCGCTG
CGGGCGCTGCCGCCCGGGGCGATGCTCGCCGTCGACGGAAGCCCGGCGGAGGTCGGCGCC
CGCACGGATCTGGACATCGCCGCGGTCAACGGCCCGTCCGCCGTGGTGCTCGCCGGTTCG
CCGGACGATGTGGCGGCGTTCGAACGGGAGTGGTCGGCGGCCGGGCGGCGCACGAAACGG
CTCGACGTCGGGCACGCGTTCCACTCCCGGCACGTCGACGGTGCGCTCGACGGCTTCCGT
ACGGTGCTGGAGTCGCTCGCGTTCGGCGCGGCGCGGCTGCCGGTGGTGTCCACGACGACG
GGCCGGGACGCCGCGGACGACCTCATAACGCCCGCGCACTGGCTGCGCCATGCGCGTCGG
CCGGTGCTGTTCTCGGATGCCGTCCGGGAGCTGGCCGACCGCGGCGTCACCACGTTCGTG
GCCGTCGGCCCCTCCGGCTCCCTGGCGTCGGCCGCGGCGGAGAGCGCCGGGGAGGACGCC
GGGACCTACCACGCGGTGCTGCGCGCCCGGACCGGTGAGGAGACCGCGGCGCTGACCGCC
CTCGCCGAGCTGCACGCCCACGGCGTCCCGGTCGACCTGGCCGCGGTACTGGCCGGTGGC
CGGCCAGTGGACCTTCCCGTGTACGCGTTCCAGCACCGTTCCTACTGGCTGGCCCCGGCC
GTGGCGGGGGCGCCGGCCACCGTGGCGGACACCGGGGGTCCGGCGGAGTCCGAGCCGGAG
GACCTCACCGTCGCCGAGATCGTCCGTCGGCGCACCGCGGCGCTGCTCGGCGTCACGGAC
CCCGCCGACGTCGATGCGGAAGCGACGTTCTTCGCGCTCGGTTTCGACTCACTGGCGGTG
CAGCGGCTGCGCAACCAGCTCGCCTCGGCAACCGGGCTGGACCTGCCGGCGGCCGTCCTG
TTCGACCACGACACCCCGGCCGCGCTCACCGCGTTCCTCCAGGACCGGATCGAGGCCGGC
CAGGACCGGATCGAGGCCGGCGAGGACGACGACGCGCCCACCGTGCTCTCGCTCCTGGAG
GAGATGGAGTCGCTCGACGCCGCGGACATCGCGGCGACGCCGGCCCCGGAGCGTGCGGCC
ATCGCCGATCTGCTCGACAAGCTCGCCCATACCTGGAAGGACTACCGATGA
[7] KS30..386
[7] AT520..747
[7] methoxymalonyl-ACP682..686
[7] DH832..993
[7] ER1257..1551
[7] KR1561..1722
[7] ACP1809..1883
[8] KS1906..2274
[8] AT2407..2642
[8] methoxymalonyl-ACP2575..2579
[8] dh2720..2853
[8] KR3096..3257
[8] ACP3352..3422
[9] KS3443..3812
[9] AT3942..4214
[9] methylmalonyl-CoA4126..4129
[9] DH4288..4457
[9] ER4717..5003
[9] KR5013..5174
[9] ACP5274..5344
[10] KS5374..5745
[10] AT5902..6210
[10] malonyl-CoA6085..6089
[10] ACP6264..6334
[7] KS88..1158
[7] AT1558..2241
[7] methoxymalonyl-ACP2044..2058
[7] DH2494..2979
[7] ER3769..4653
[7] KR4681..5166
[7] ACP5425..5649
[8] KS5716..6822
[8] AT7219..7926
[8] methoxymalonyl-ACP7723..7737
[8] dh8158..8559
[8] KR9286..9771
[8] ACP10054..10266
[9] KS10327..11436
[9] AT11824..12642
[9] methylmalonyl-CoA12376..12387
[9] DH12862..13371
[9] ER14149..15009
[9] KR15037..15522
[9] ACP15820..16032
[10] KS16120..17235
[10] AT17704..18630
[10] malonyl-CoA18253..18267
[10] ACP18790..19002

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [511-621]  G3DSA:3.40.366.10 [682-762]  G3DSA:3.40.366.10 [2397-2514]  G3DSA:3.40.366.10 [2575-2653]  G3DSA:3.40.366.10 [3935-4062]  G3DSA:3.40.366.10 [4126-4231]  G3DSA:3.40.366.10 [5892-6023]  G3DSA:3.40.366.10 [6085-6200]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1841-1856]  PS00012 [3380-3395]  PS00012 [5302-5317]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1817-1879]  4.40000000000001e-10 PF00550 [3360-3419]  2.9e-13 PF00550 [5277-5343]  2.6e-11 PF00550 [6269-6333]  1.3e-11 PF00550
PF00550   PP-binding
 [1811-1887]  9.49999999999983e-77 G3DSA:1.10.1200.10 [3352-3423]  9.49999999999983e-77 G3DSA:1.10.1200.10 [5274-5347]  9.49999999999983e-77 G3DSA:1.10.1200.10 [6264-6338]  9.49999999999983e-77 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1809-1883]  PS50075 [3352-3422]  PS50075 [5274-5344]  PS50075 [6264-6334]  PS50075
PS50075   ACP_DOMAIN
 [1811-1922]  3.1999989904635e-24 SSF47336 [3345-3459]  6.39998633403535e-27 SSF47336 [5267-5391]  1.29999924468179e-23 SSF47336 [6264-6340]  1.70000295590054e-17 SSF47336
SSF47336   ACP_like
IPR011032 GroES-like (Domain)
 [1245-1391]  4.80000830876748e-32 SSF50129 [4711-4862]  5.00000909915354e-32 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1277-1331]  2e-07 PF08240 [4737-4792]  1.5e-06 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1561-1722]  2.29999999999998e-47 PF08659 [3098-3256]  2.89999999999999e-43 PF08659 [5013-5174]  3.5e-45 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [30-262]  3.30000000000002e-81 PF00109 [1906-2151]  1.60000000000002e-90 PF00109 [3443-3688]  8.70000000000003e-94 PF00109 [5374-5621]  1.20000000000001e-89 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [270-386]  5.10000000000004e-49 PF02801 [2159-2274]  4.30000000000003e-47 PF02801 [3696-3812]  6.40000000000004e-48 PF02801 [5629-5745]  1.80000000000002e-42 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [520-747]  3.2e-30 PF00698 [2407-2642]  4.80000000000003e-42 PF00698 [3942-4214]  1e-83 PF00698 [5902-6210]  1.99999999999999e-57 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-26]  1e-06 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [518-766]  9.10000425645573e-39 SSF52151 [2405-2673]  7.20002719778969e-45 SSF52151 [3940-4213]  1.49999648196323e-53 SSF52151 [5899-6194]  3.80000697093588e-62 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [623-681]  4.00000300869883e-11 SSF55048 [2516-2574]  1.09999909120787e-10 SSF55048 [4065-4125]  1e-14 SSF55048 [6024-6084]  1.59999889349252e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-274]  G3DSA:3.40.47.10 [275-438]  G3DSA:3.40.47.10 [1906-2162]  G3DSA:3.40.47.10 [2163-2325]  G3DSA:3.40.47.10 [3446-3700]  G3DSA:3.40.47.10 [3702-3863]  G3DSA:3.40.47.10 [5377-5633]  G3DSA:3.40.47.10 [5634-5796]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [22-438]  1.79999754022378e-97 SSF53901 [1898-2273]  7.19996395544006e-102 SSF53901 [3435-3810]  2.50000909916183e-103 SSF53901 [5367-5743]  7.29994178862692e-94 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1393-1481]  1e-23 G3DSA:3.40.50.720 [1563-1728]  1.9e-80 G3DSA:3.40.50.720 [3092-3315]  3.39999999999996e-79 G3DSA:3.40.50.720 [4852-4950]  1e-23 G3DSA:3.40.50.720 [5013-5191]  3.39999999999996e-79 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [175-191]  PS00606 [2064-2080]  PS00606 [3601-3617]  PS00606 [5534-5550]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [522-779]  1.20000117458134e-63 SM00827 [2409-2706]  3.19999899046355e-73 SM00827 [3944-4222]  1.39999277195148e-93 SM00827 [5903-6191]  3.60002015031011e-91 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1814-1886]  1.70000295590054e-27 SM00823 [3353-3425]  1e-31 SM00823 [5275-5347]  2.9000035467798e-31 SM00823 [6265-6337]  7.30000590915208e-25 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [832-993]  4.20003460493095e-80 SM00826 [2720-2853]  1.60000240695997e-23 SM00826 [4288-4457]  4.69998262513189e-73 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [32-438]  SM00825 [1908-2327]  SM00825 [3445-3864]  SM00825 [5377-5797]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1561-1722]  3.70001063537244e-45 SM00822 [3096-3257]  1.20000117458134e-39 SM00822 [5013-5174]  2.39999798157265e-41 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1257-1551]  SM00829 [4717-5003]  SM00829
SM00829   PKS_ER
SignalP
 [1-46]  0.057 Signal
Eukaryota   
TMHMM No significant hit