close all open/close all

CDS information : Asco_00180


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction71,460 / 72,626 / + [in whole cluster]
71,460 / 72,626 / + [in contig]
Location71460..72626 [in whole cluster]
71460..72626 [in contig]
TypeCDS
Length1,167 bp (388 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)FkbD
Gene
Gene (GenBank)fkbD
EC number
Keyword
  • C-9 hydroxylate
Note
Note (GenBank)
  • C9 hydroxylase
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
Related Reference
ACC
P77977
PmId
[8752344] Characterization of methyltransferase and hydroxylase genes involved in the biosynthesis of the immunosuppressants FK506 and FK520. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative cytochrome P450 [FkbD]
MSTDTHEGTPPAGRCPFAIQDGHRAILESGTVGSFDLFGVKHWLVAAAEDVKLVTNDPRF
SSAAPSEMLPDRRPGWFSGMDSPEHNRYRQKIAGDFTLRAARKREDFVAEAADACLDDIE
AAGPGTDLIPGYAKRLPSLVINALYGLTPEEGAVLEARMRDITGSADLDSVKTLTDDFFG
HALRLVRAKRDERGEDLLHRLASADDGEISLSDDEATGVFATLLFAGHDSVQQMVGYCLY
ALLSHPEQQAALRARPELVDNAVEEMLRFLPVNQMGVPRVCVEDVDVRGVRIRAGDNVIP
LYSTANRDPEVFPQPDTFDVTRPLEGNFAFGHGIHKCPGQHIARVLIKVACLRLFERFPD
VRLAGDVPMNEGLGLFSPAELRVTWGAA
selected fasta
>putative cytochrome P450 [FkbD]
ATGAGCACCGATACGCACGAGGGAACGCCGCCCGCCGGCCGCTGCCCATTCGCGATCCAG
GACGGTCACCGCGCCATCCTGGAGAGCGGCACGGTGGGTTCGTTCGACCTGTTCGGCGTC
AAGCACTGGCTGGTCGCCGCCGCCGAGGACGTCAAGCTGGTCACCAACGATCCGCGGTTC
AGCTCGGCCGCGCCGTCCGAGATGCTGCCCGACCGGCGGCCCGGCTGGTTCTCCGGGATG
GACTCACCGGAGCACAACCGCTACCGGCAGAAGATCGCGGGGGACTTCACACTGCGCGCG
GCGCGCAAGCGGGAGGACTTCGTCGCCGAGGCCGCCGACGCCTGCCTGGACGACATCGAG
GCCGCGGGACCCGGCACCGACCTCATCCCCGGGTACGCCAAGCGGCTGCCCTCCCTCGTC
ATCAACGCGCTGTACGGGCTCACCCCTGAGGAGGGGGCCGTGCTGGAGGCACGGATGCGC
GACATCACCGGCTCGGCCGATCTGGACAGCGTCAAGACGCTGACCGACGACTTCTTCGGG
CACGCGCTGCGGCTGGTCCGCGCGAAGCGTGACGAGCGGGGCGAGGACCTGCTGCACCGG
CTGGCCTCGGCCGACGACGGCGAGATCTCGCTCAGCGACGACGAGGCGACGGGCGTGTTC
GCGACGCTGCTGTTCGCCGGCCACGACTCGGTGCAGCAGATGGTCGGCTACTGCCTCTAC
GCACTGCTCAGCCACCCCGAGCAGCAGGCGGCGCTGCGCGCGCGCCCGGAGCTGGTCGAC
AACGCGGTCGAGGAGATGCTCCGTTTCCTGCCCGTCAACCAGATGGGCGTACCGCGCGTC
TGTGTCGAGGACGTCGATGTGCGGGGCGTGCGCATCCGTGCGGGCGACAACGTGATCCCG
CTCTACTCGACGGCCAACCGCGACCCCGAGGTGTTCCCGCAGCCCGACACCTTCGATGTG
ACGCGCCCGCTGGAGGGCAACTTCGCGTTCGGCCACGGCATTCACAAGTGTCCCGGCCAG
CACATCGCCCGGGTGCTCATCAAGGTCGCCTGCCTGCGGTTGTTCGAGCGTTTCCCGGAC
GTCCGGCTGGCCGGCGACGTGCCGATGAACGAGGGGCTCGGGCTGTTCAGCCCGGCCGAG
CTGCGGGTCACCTGGGGGGCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [7-385]  1.19999063421924e-85 SSF48264
SSF48264   Cytochrome_P450
 [25-385]  1.9e-92 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [175-358]  1.3e-31 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [80-91]  1.10000150671643e-38 PR00359 [127-143]  1.10000150671643e-38 PR00359 [180-202]  1.10000150671643e-38 PR00359 [261-272]  1.10000150671643e-38 PR00359 [279-306]  1.10000150671643e-38 PR00359 [307-322]  1.10000150671643e-38 PR00359 [328-337]  1.10000150671643e-38 PR00359 [337-348]  1.10000150671643e-38 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [330-339]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit