close all open/close all

CDS information : Asco_00190


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction72,623 / 73,405 / + [in whole cluster]
72,623 / 73,405 / + [in contig]
Location72623..73405 [in whole cluster]
72623..73405 [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-31 O-methyltransferase
Product (GenBank)FkbM
Gene
Gene (GenBank)fkbM
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • 31-O-methyltransferase
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
[8752344] Characterization of methyltransferase and hydroxylase genes involved in the biosynthesis of the immunosuppressants FK506 and FK520. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>C-31 O-methyltransferase [FkbM]
MSHPVETLRLPNGTTVAHINAGEAQFLYREIFTQRCYLRHGVDLRPGDVVFDVGANIGMF
TLFAHLECPGVTVHAFEPAPVPFAALRANVTRHGIPGQADQCAVSDSSGTRKMTFYPDAT
LMSGFHADAAARTELLRTLGLNGGYTAEDVDTMLAQLPDVSEEIETPVVRLSDVIAERGI
EAIGLLKVDVEKSERQVFAGLEDTDWPRIRQVVAEVHDIDGALEEVVTLLRGHGFTVVAE
QEPLFAGTGIHQVAARRVAG
selected fasta
>C-31 O-methyltransferase [FkbM]
ATGAGTCACCCGGTGGAGACGTTGCGGTTGCCGAACGGGACGACGGTCGCGCACATCAAC
GCGGGCGAGGCGCAGTTCCTCTACCGGGAGATCTTCACCCAGCGCTGCTACCTGCGCCAC
GGTGTCGACCTGCGCCCGGGGGACGTGGTGTTCGACGTCGGCGCGAACATCGGCATGTTC
ACGCTTTTCGCGCATCTGGAGTGTCCTGGTGTGACCGTGCACGCCTTCGAGCCCGCGCCC
GTGCCGTTCGCGGCGCTGCGGGCGAACGTGACGCGGCACGGCATCCCGGGCCAGGCGGAC
CAGTGCGCGGTCTCCGACAGCTCCGGCACCCGGAAGATGACCTTCTATCCCGACGCCACG
CTGATGTCCGGTTTCCACGCGGATGCCGCGGCCCGGACGGAGCTGTTGCGCACGCTCGGC
CTCAACGGCGGCTACACCGCCGAGGACGTCGACACCATGCTCGCGCAACTGCCCGACGTC
AGCGAGGAGATCGAAACCCCTGTGGTCCGGCTCTCCGACGTCATCGCGGAGCGCGGTATC
GAGGCCATCGGCCTGCTGAAGGTCGACGTGGAGAAGAGCGAACGGCAGGTCTTCGCCGGC
CTCGAGGACACCGACTGGCCCCGTATCCGCCAGGTCGTCGCGGAGGTCCACGACATCGAC
GGCGCGCTCGAGGAGGTCGTCACGCTGCTCCGCGGCCATGGCTTCACCGTGGTCGCCGAG
CAGGAACCGCTGTTCGCCGGCACGGGCATCCACCAGGTCGCCGCGCGGCGGGTGGCCGGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006342 Methyltransferase FkbM (Domain)
 [49-217]  2.5e-30 TIGR01444
TIGR01444   FkbM_fam
 [52-236]  8.59999999999999e-22 PF05050
PF05050   Methyltransf_21
SignalP No significant hit
TMHMM No significant hit