close all open/close all

CDS information : Asco_00200


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction76,200 / 73,459 / - [in whole cluster]
76,200 / 73,459 / - [in contig]
Locationcomplement(73459..76200) [in whole cluster]
complement(73459..76200) [in contig]
TypeCDS
Length2,742 bp (913 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional regulator
Product (GenBank)FkbN
Gene
Gene (GenBank)fkbN
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
[26608164] Interspecies Complementation of the LuxR Family Pathway-Specific Regulator Involved in Macrolide Biosynthesis. (J Microbiol Biotechnol. , 2016)
Related Reference
ACC
Q54307
NITE
Rapam_00230
PmId
[17468238] Roles of rapH and rapG in positive regulation of rapamycin biosynthesis in Streptomyces hygroscopicus. (J Bacteriol. , 2007)
[26608164] Interspecies Complementation of the LuxR Family Pathway-Specific Regulator Involved in Macrolide Biosynthesis. (J Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>LuxR family transcriptional regulator [FkbN]
MIARLSPPDLIARDDEFGSLHRALTRAGGGRGVVAAVTGPIACGKTELLDAAAAKAGFVT
LRAVCSMEERALPYGMLGQLLDQPELAARTPELVRLTASCENLPADVDNRLGTELTRTVL
TLAAERPVLIGIDDVHHADAPSLRCLLHLARRISRARVAIVLTELLRPTPAHSQFRAALL
SLRHYQEIALRPLTEAQTTELVRRHLGQDAHDDVVAQAFRATGGNLLLGHGLIDDIREAR
TRTSGCLEVVAGRAYRLAYLGSLYRCGPAALSVARASAVLGESVELTLVQRMTGLDTEAV
EQAHEQLVEGRLLREGRFPHPAARSVVLDDLSAAERRGLHELALELLRDRGVASKVLARH
QMGTGRVHGAEVAGLFTDAAREHHLRGELDEAVTYLEFAYRASDDPAVHAALRVDTAAIE
RLCDPARSGRHVPELLTASRERLLSSEHAVSLACWLAMDGRPGEAAEVLAAQRSAAPSEQ
GRAHLRVADLSLALIYPGAADPPRPADPPAEDEVASFSGAVRHRAVADKALSNALRGWSE
QAEAKAEYVLQHSRVTTDRTTTMMALLALLYAEDTDAVQSWVDKLAGDDNMRTPADEAVH
AGFRAEAALRRGDLTAAVECGEAALAPRVVPSWGMAAALPLSSTVAAAIRLGDLDRAERW
LAEPLPEETSDSLFGLHMVWARGQHHLAAGRYRAAYNAFRDCGERMRRWSVDVPGLALWR
VDAAEALLLLGRGRDEGLRLISEQLSRPMGSRARVMTLRVQAAYSPPAKRIELLDEAADL
LIMCRDQYELARVLADMGEACGMLRRHSRARGLFRRARHLATQCGAVPLLRRLGGESSDA
DGTQDVTPAQRITSLTEAERRVASHAAVGRTNKEIASQLFVTSSTVEQHLTNVFRKLGVK
GRQQLPKELSDAG
selected fasta
>LuxR family transcriptional regulator [FkbN]
GTGATAGCGCGCTTATCTCCCCCAGACCTGATCGCCCGCGATGACGAGTTCGGTTCCCTC
CACCGGGCGCTCACCCGAGCGGGGGGCGGGCGGGGCGTCGTCGCCGCCGTCACCGGGCCG
ATCGCCTGCGGCAAGACCGAACTCCTCGACGCCGCCGCGGCCAAGGCCGGCTTCGTCACC
CTTCGCGCGGTGTGCTCCATGGAGGAGCGGGCCCTGCCGTACGGCATGCTCGGCCAGCTC
CTCGACCAGCCCGAGCTGGCCGCCCGGACACCGGAGCTGGTCCGGCTGACGGCATCGTGC
GAAAACCTGCCGGCCGACGTCGACAACCGCCTGGGGACCGAACTCACCCGCACGGTGCTG
ACGCTCGCCGCGGAGCGGCCCGTACTGATCGGCATCGACGACGTGCACCACGCCGACGCG
CCGTCGCTGCGCTGCCTGCTCCACCTCGCGCGCCGCATCAGCCGGGCCCGTGTCGCCATC
GTGCTGACCGAGCTGCTCCGGCCGACGCCCGCCCACTCCCAATTCCGGGCGGCACTGCTG
AGTCTGCGCCACTACCAGGAGATCGCGCTGCGCCCGCTCACCGAGGCGCAGACCACCGAA
CTCGTGCGCCGGCACCTCGGCCAGGACGCGCACGACGACGTGGTGGCCCAGGCGTTCCGG
GCGACCGGCGGCAACCTGCTCCTCGGCCACGGCCTGATCGACGACATCCGGGAGGCACGG
ACACGGACCTCAGGGTGCCTGGAAGTGGTCGCGGGGCGGGCGTACCGGCTCGCCTACCTC
GGGTCGCTCTATCGTTGCGGCCCGGCCGCGCTGAGCGTCGCCCGAGCTTCCGCCGTGCTC
GGCGAGAGTGTCGAACTCACCCTCGTCCAGCGGATGACCGGCCTCGACACCGAGGCGGTC
GAGCAGGCCCACGAACAGCTGGTCGAGGGGCGGCTGCTGCGGGAAGGGCGGTTCCCGCAC
CCCGCGGCCCGCTCCGTCGTACTCGACGACCTCTCCGCCGCCGAGCGGCGTGGCCTGCAC
GAGCTGGCGCTGGAACTGCTGCGGGACCGCGGCGTGGCCAGCAAGGTGCTCGCCCGCCAC
CAGATGGGTACCGGCCGGGTGCACGGCGCCGAGGTCGCCGGGCTGTTCACCGACGCCGCG
CGCGAGCACCACCTGCGCGGCGAGCTCGACGAGGCCGTCACCTACCTGGAGTTCGCCTAC
CGGGCCTCCGACGACCCCGCCGTCCACGCCGCACTGCGCGTCGACACCGCCGCCATCGAG
CGGCTCTGCGATCCCGCCAGATCCGGCCGGCATGTGCCCGAGCTGCTCACCGCGTCGCGG
GAACGGCTCCTCTCCAGCGAGCACGCCGTGTCGCTCGCCTGCTGGCTGGCGATGGACGGG
CGGCCGGGCGAGGCCGCCGAGGTCCTGGCGGCCCAGCGCTCCGCCGCCCCGAGCGAGCAG
GGCCGGGCGCACCTGCGCGTCGCGGACCTGTCCCTCGCGCTGATCTATCCCGGCGCGGCC
GATCCGCCGCGTCCGGCCGATCCGCCGGCCGAGGACGAGGTCGCCTCGTTTTCCGGAGCC
GTCCGGCACCGCGCCGTCGCCGACAAGGCCCTGAGCAACGCGCTGCGCGGCTGGTCCGAA
CAGGCCGAGGCCAAAGCCGAGTACGTGCTCCAGCACTCCCGGGTCACGACGGACCGGACC
ACGACCATGATGGCGTTGCTGGCCCTGCTCTACGCCGAGGACACCGATGCCGTCCAGTCC
TGGGTCGACAAGCTGGCCGGTGACGACAACATGCGGACCCCGGCCGACGAGGCGGTCCAC
GCGGGGTTCCGCGCCGAGGCCGCGCTGCGCCGCGGCGACCTGACCGCCGCCGTCGAATGC
GGCGAGGCCGCGCTCGCCCCCCGGGTCGTGCCCTCCTGGGGGATGGCCGCCGCATTGCCG
CTGAGCAGCACCGTGGCCGCCGCGATCCGACTGGGCGACCTGGACCGGGCGGAGCGGTGG
CTCGCCGAGCCGTTGCCGGAGGAGACCTCCGACAGCCTCTTCGGACTGCACATGGTCTGG
GCCCGTGGGCAACACCATCTCGCGGCCGGGCGGTACCGGGCGGCGTACAACGCGTTCCGG
GACTGCGGGGAGCGGATGCGACGCTGGTCCGTCGACGTGCCGGGCCTGGCCCTGTGGCGG
GTCGACGCCGCCGAAGCGCTTCTGCTGCTCGGCCGCGGCCGTGACGAGGGGCTGAGGCTC
ATCTCCGAGCAGCTGTCCCGGCCGATGGGGTCCCGGGCGCGGGTGATGACGCTGCGGGTG
CAGGCGGCCTACAGTCCGCCGGCCAAGCGGATCGAACTGCTCGACGAGGCCGCCGATCTG
CTCATCATGTGCCGCGACCAGTACGAGCTGGCCCGCGTCCTCGCCGACATGGGCGAAGCG
TGCGGCATGCTCCGGCGGCACAGCCGTGCGCGGGGACTGTTCCGCCGCGCACGGCACCTC
GCGACCCAGTGCGGAGCCGTGCCGCTCCTCCGGCGGCTCGGTGGGGAGTCCTCGGACGCG
GACGGCACCCAGGACGTGACGCCGGCGCAGCGGATCACATCGCTGACCGAGGCGGAGCGG
CGGGTGGCGTCGCACGCCGCGGTCGGGCGCACCAACAAGGAGATCGCCAGCCAGCTGTTC
GTCACCTCCAGCACGGTGGAACAGCACCTCACCAACGTGTTCCGCAAGCTGGGGGTGAAG
GGCCGTCAGCAACTGCCCAAGGAACTGTCCGACGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [855-869]  1.69999922284049e-09 PR00038 [869-885]  1.69999922284049e-09 PR00038 [885-897]  1.69999922284049e-09 PR00038
PR00038   HTHLUXR
 [869-896]  PS00622
PS00622   HTH_LUXR_1
 [854-905]  3e-14 PF00196
PF00196   GerE
 [848-913]  PS50043
PS50043   HTH_LUXR_2
 [852-909]  8.70001261213513e-21 SM00421
SM00421   HTH_LUXR
IPR011990 Tetratricopeptide-like helical (Domain)
 [536-710]  2.1e-11 G3DSA:1.25.40.10 [792-862]  2.1e-11 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [863-906]  1.4e-18 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [833-913]  3.59999643435987e-15 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit