close all open/close all

CDS information : Asco_00210


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction77,078 / 76,335 / - [in whole cluster]
77,078 / 76,335 / - [in contig]
Locationcomplement(76335..77078) [in whole cluster]
complement(76335..77078) [in contig]
TypeCDS
Length744 bp (247 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)FkbQ
Gene
Gene (GenBank)fkbQ
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • thioesterase II
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative type II thioesterase [FkbQ]
MSSELWLRQFFPTPEAPVRVVLLPHAGGSATFYLPLARALAPVADVYAVQYPGRQDRRDE
EAVRDLRVLAGLVAEALKPGLDRPLVLFGHSMGATLAFELAQRLPVAHLIVSGRRAPSQP
RADQDHLASDDELLAAVIGLGGTSADVMADDEMRALILAPLRADYYAAETYRWEPAPPLE
TPITVCIGDDDPKTTVEQAHAWAGHTTAPTTVEVFPGGHFYLVDHQERVAELVAQGVRRV
APGAVGS
selected fasta
>putative type II thioesterase [FkbQ]
GTGAGCTCGGAACTCTGGCTGCGGCAGTTCTTCCCCACGCCCGAGGCCCCGGTACGGGTG
GTGCTGCTGCCCCACGCCGGCGGATCGGCGACGTTCTACCTTCCGCTGGCCCGTGCGCTC
GCCCCGGTGGCGGACGTGTACGCCGTGCAGTACCCCGGCCGCCAGGACCGCCGCGACGAG
GAGGCGGTGCGCGACCTGCGTGTTCTCGCCGGCCTCGTGGCCGAGGCGTTGAAGCCGGGG
CTGGACCGTCCGCTGGTGCTGTTCGGCCACAGCATGGGCGCGACACTCGCGTTCGAGCTG
GCCCAGCGGCTCCCGGTGGCGCACCTGATCGTCTCGGGCCGGCGGGCGCCGTCGCAGCCG
CGCGCCGACCAGGACCACCTCGCGTCCGACGACGAGCTGCTGGCGGCGGTCATCGGCCTC
GGCGGGACGAGCGCCGATGTGATGGCGGACGACGAAATGCGCGCGCTGATCCTGGCGCCG
TTGCGGGCGGACTACTACGCGGCGGAGACGTACCGGTGGGAGCCCGCGCCGCCGCTGGAG
ACGCCGATCACGGTGTGCATCGGTGACGACGATCCGAAGACGACGGTGGAGCAGGCCCAC
GCCTGGGCCGGGCACACGACCGCGCCGACCACGGTGGAGGTCTTCCCCGGCGGGCACTTC
TACCTCGTCGACCACCAGGAGCGGGTCGCCGAGCTGGTGGCCCAGGGGGTACGGCGGGTG
GCGCCGGGGGCGGTCGGCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [19-235]  6.59999999999996e-49 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit