close all open/close all
Asco_00210 Asco_00210   last last

CDS information : Asco_00220


close this sectionLocation

Organism
StrainATCC 14891 (=NBRC 13981)
Entry nameAscomycin
Contig
Start / Stop / Direction77,497 / 77,075 / - [in whole cluster]
77,497 / 77,075 / - [in contig]
Locationcomplement(77075..77497) [in whole cluster]
complement(77075..77497) [in contig]
TypeCDS
Length423 bp (140 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative crotonyl-CoA reductase(fragment)
Product (GenBank)FkbS
Gene
Gene (GenBank)fkbS
EC number
Keyword
  • ethylmalonyl-CoA
Note
Note (GenBank)
  • crotonyl CoA reductase
Reference
ACC
PmId
[10863099] The FK520 gene cluster of Streptomyces hygroscopicus var. ascomyceticus (ATCC 14891) contains genes for biosynthesis of unusual polyketide extender units. (Gene. , 2000)
Related Reference
ACC
Q9RNU6
PmId
[10542184] Role of crotonyl coenzyme A reductase in determining the ratio of polyketides monensin A and monensin B produced by Streptomyces cinnamonensis. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative crotonyl-CoA reductase(fragment) [FkbS]
MFEHPGRATFGASVYVTRRGGTIVTCASTSGYEHAFDNRYLWMSVKRIIGTHFANYREAW
EANRLICKGMVHPTLSVTYPLDDVGSAVRDVHRNVHNGKVGVLCLAPEEGWGVTDPEMRE
KHLAEITRFRAPQVAAEGVR
selected fasta
>putative crotonyl-CoA reductase(fragment) [FkbS]
GTGTTCGAGCACCCGGGGCGCGCGACGTTCGGCGCGAGTGTCTACGTGACACGTCGGGGT
GGCACGATCGTCACCTGCGCGTCAACCTCGGGATACGAGCACGCCTTTGACAATCGGTAC
CTGTGGATGTCCGTGAAGCGGATCATCGGTACCCACTTCGCGAACTATCGTGAGGCGTGG
GAGGCGAACCGCCTGATCTGCAAGGGGATGGTGCACCCGACGCTGTCGGTGACCTACCCG
CTCGACGACGTCGGGTCGGCGGTGCGCGATGTGCATCGCAATGTGCACAACGGCAAAGTC
GGCGTCCTCTGTCTGGCGCCGGAGGAGGGATGGGGCGTGACCGACCCGGAGATGCGGGAG
AAGCACTTGGCCGAGATCACCCGGTTCCGGGCTCCCCAGGTCGCGGCCGAGGGGGTGCGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [2-66]  5.6e-16 PF00107
PF00107   ADH_zinc_N
IPR016040 NAD(P)-binding domain (Domain)
 [2-56]  4.6e-05 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP
 [1-35]  0.263 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
Asco_00210 Asco_00210   last last