close all open/close all
first first   Aureo_00020 Aureo_00020

CDS information : Aureo_00010


close this sectionLocation

Organism
StrainHKI-227
Entry nameAureothin
Contig
Start / Stop / Direction2,154 / 2,969 / + [in whole cluster]
2,154 / 2,969 / + [in contig]
Location2154..2969 [in whole cluster]
2154..2969 [in contig]
TypeCDS
Length816 bp (271 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)AurD protein
Gene
Gene (GenBank)aurD
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[14700630] Iteration as programmed event during polyketide assembly; molecular analysis of the aureothin biosynthesis gene cluster. (Chem Biol. , 2003)
Related Reference
ACC
P46106
NITE
Actino_00160
PmId
[1878971] The act cluster contains regulatory and antibiotic export genes, direct targets for translational control by the bldA tRNA gene of Streptomyces. (Cell. , 1991)
[7683365] Stationary-phase production of the antibiotic actinorhodin in Streptomyces coelicolor A3(2) is transcriptionally regulated. (Mol Microbiol. , 1993)

close this sectionSequence

selected fasta
>putative transcriptional regulator [AurD protein]
MVNAVVKLPSDLSFNILGPVAVSSTEGPLPLGPARQRAVLSALLLAPGQVVGAERLTEAI
WPAGPPGNAVASLHSYVSHLRRQLEPDCPPWGRNRILRREPQGYLLAVEAERVDARRFEG
LLREGRQLLREGRYPEASQVLRACLELWRGSPYAELGDYEPAVCEAARLEELRLATLEAL
WEAELAWGHDYVTAIAELAAVSARFPTRERLGWLLMVALCEVDRQAEAVAVYNRIRKALA
QELGVDPGRELRSLFARILRDESVGRACLQS
selected fasta
>putative transcriptional regulator [AurD protein]
CTGGTGAATGCCGTTGTGAAACTCCCGTCCGACTTATCCTTCAACATCCTCGGGCCGGTG
GCGGTGTCGTCGACGGAGGGCCCGCTGCCGCTGGGCCCGGCGCGTCAACGCGCCGTGCTG
TCGGCCCTGTTGCTGGCGCCGGGGCAGGTGGTCGGGGCGGAGCGGCTCACGGAGGCGATA
TGGCCGGCGGGCCCTCCCGGCAACGCCGTCGCAAGTCTCCACAGCTACGTCTCCCACCTC
CGCCGCCAACTGGAGCCCGACTGCCCGCCCTGGGGCCGCAACCGGATCCTCCGCCGGGAG
CCGCAGGGCTATCTCCTCGCCGTCGAGGCGGAACGGGTGGACGCCCGGCGCTTCGAGGGT
CTGCTGCGCGAGGGGCGCCAACTGCTGCGGGAGGGCCGCTACCCGGAGGCGAGCCAGGTC
CTCCGGGCATGCCTGGAGCTGTGGCGCGGCTCGCCGTACGCCGAACTCGGCGACTACGAG
CCCGCCGTGTGCGAGGCGGCGCGCCTGGAGGAGCTGCGCCTGGCGACGCTGGAGGCCCTC
TGGGAGGCCGAGCTGGCCTGGGGGCACGACTACGTCACGGCCATCGCCGAACTGGCCGCG
GTGAGCGCGCGGTTCCCCACCCGCGAACGGCTGGGGTGGCTGCTGATGGTCGCCCTGTGC
GAGGTCGACCGGCAGGCGGAGGCGGTGGCGGTGTACAACCGCATCCGCAAGGCGCTGGCC
CAGGAACTGGGCGTGGACCCGGGCCGGGAGCTGCGGTCGCTGTTCGCGCGGATCCTGCGT
GACGAGTCCGTCGGGCGGGCCTGCCTGCAGAGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [34-106]  2.8e-11 PF00486
PF00486   Trans_reg_C
 [26-106]  2.00000075217456e-12 SM00862
SM00862   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [113-259]  2.80000000000001e-36 PF03704
PF03704   BTAD
 [113-259]  1.99999636034521e-37 SM01043
SM01043   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [119-236]  5.8e-05 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [34-108]  1.1e-08 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [11-107]  5.59999989417023e-14 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit
first first   Aureo_00020 Aureo_00020