close all open/close all

CDS information : Aureo_00020


close this sectionLocation

Organism
StrainHKI-227
Entry nameAureothin
Contig
Start / Stop / Direction4,546 / 3,029 / - [in whole cluster]
4,546 / 3,029 / - [in contig]
Locationcomplement(3029..4546) [in whole cluster]
complement(3029..4546) [in contig]
TypeCDS
Length1,518 bp (505 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative carboxylic acid--CoA ligase
putative acyl-CoA synthetase
Product (GenBank)putative acyl-coA ligase
Gene
Gene (GenBank)aurE
EC number6.2.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14700630] Iteration as programmed event during polyketide assembly; molecular analysis of the aureothin biosynthesis gene cluster. (Chem Biol. , 2003)
[23606628] Multifactorial control of iteration events in a modular polyketide assembly line. (Angew Chem Int Ed Engl. , 2013)
Related Reference
ACC
Q9EY88
PmId
[11152072] Identification of Amycolatopsis sp. strain HR167 genes, involved in the bioconversion of ferulic acid to vanillin. (Appl Microbiol Biotechnol. , 2000)

close this sectionSequence

selected fasta
>putative carboxylic acid--CoA ligase [putative acyl-coA ligase]
MLVPLTTADFLDRAEATAAARTALVDEPHQPAAALPTSTYGETLRRVRAWQAGLDALGID
EGERVAVVSPNSARLLELLYAVTASGRICVPVNYRLTPEEISYILRQCDASVVFVDPDVE
AVLGSVDVPKRFVLGEQTETEVMRFDVAPRPWSRPDENAVATLNYTSGTSARPKGVALTH
RSIWLNAMTFGVHARIWEGDVYLHTLPTFHCNGWGVPFLLAGLGAKQVLIRRIDGAEILR
RVQEHGVTLAFGAPAVWDAVLQAARDWPGEIPGRGRVRVVCAGAPVSAQLVSRIENELGW
EFLQVYGLTETTLLTFNRRLPDAPGDGGLTRAGAPALGVRLRTGERGEVLARSNMVLDSY
WRDEQANEAALEDGWFRTGDVGAFDDEGHLALFDRVKDVIVTGGESVSSVEVEDCLQGHP
SIAEVAVIGVPDERWGETVKAVVVPADGARVTEEEVITYCKQQLARYKAPTSVDFRDALP
RTSNGKIQKGRLREPYWAGHDRRIH
selected fasta
>putative carboxylic acid--CoA ligase [putative acyl-coA ligase]
ATGCTCGTTCCGCTCACCACGGCCGATTTCCTCGACCGCGCCGAGGCAACCGCCGCCGCC
CGCACCGCACTTGTCGACGAGCCGCACCAGCCGGCCGCCGCGCTGCCCACCAGTACGTAC
GGGGAGACGCTGCGGCGCGTCCGCGCCTGGCAGGCCGGCCTGGACGCGCTGGGGATCGAC
GAGGGCGAACGGGTCGCCGTCGTCAGCCCCAACTCGGCCCGGCTGCTGGAGCTCCTCTAC
GCGGTCACGGCGAGCGGACGCATCTGCGTCCCGGTGAACTACCGGCTCACGCCCGAGGAG
ATCTCCTACATCCTGCGCCAGTGCGACGCGTCCGTCGTCTTCGTCGACCCCGACGTCGAG
GCGGTCCTGGGCTCGGTCGACGTGCCGAAGCGGTTCGTCCTCGGCGAGCAGACCGAGACC
GAGGTCATGCGGTTCGACGTCGCCCCCCGCCCCTGGTCACGGCCCGACGAGAACGCGGTC
GCGACCCTCAACTACACCTCGGGCACCTCCGCCCGCCCCAAGGGCGTCGCGCTCACCCAC
CGCAGCATCTGGCTCAACGCGATGACCTTCGGCGTCCACGCCCGGATCTGGGAGGGGGAC
GTCTACCTCCACACCCTGCCCACGTTCCACTGCAACGGCTGGGGCGTGCCGTTCCTCCTC
GCCGGGCTCGGCGCCAAGCAGGTCCTGATCCGCCGGATCGACGGCGCGGAGATCCTGCGC
CGCGTCCAGGAGCACGGCGTGACGCTGGCCTTCGGCGCCCCCGCCGTGTGGGACGCGGTG
CTCCAGGCCGCCCGCGACTGGCCGGGCGAGATCCCCGGCCGCGGCCGGGTCCGCGTGGTC
TGCGCGGGAGCCCCCGTCAGCGCACAGCTGGTCTCCCGCATAGAGAACGAACTGGGCTGG
GAGTTCCTCCAGGTCTACGGCCTCACCGAGACGACGCTGCTCACCTTCAACCGGCGCCTG
CCGGACGCCCCCGGGGACGGCGGGCTGACGAGGGCCGGCGCCCCCGCCCTGGGCGTGCGG
CTGCGCACCGGGGAGCGCGGCGAGGTGCTGGCGCGCTCCAACATGGTGCTCGACAGCTAC
TGGCGCGACGAGCAGGCCAATGAAGCCGCGCTGGAGGACGGCTGGTTCCGCACCGGCGAC
GTGGGCGCCTTCGACGACGAGGGGCACCTGGCCCTCTTCGACCGGGTGAAGGACGTCATC
GTCACCGGCGGCGAGAGCGTGTCCTCGGTGGAGGTCGAGGACTGCCTCCAGGGCCACCCC
TCCATCGCCGAAGTGGCCGTCATCGGCGTCCCGGACGAGCGGTGGGGCGAGACCGTCAAG
GCGGTCGTCGTCCCCGCCGACGGGGCCCGGGTCACCGAGGAAGAGGTCATCACCTACTGC
AAACAGCAGCTGGCCCGGTACAAGGCGCCCACGTCCGTGGACTTCCGGGACGCCCTGCCC
CGGACCAGCAACGGCAAGATCCAGAAGGGCCGGCTCAGGGAGCCCTACTGGGCCGGCCAC
GACCGGCGGATCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [39-427]  9.10000000000013e-84 PF00501
PF00501   AMP-binding
IPR025110 Domain of unknown function DUF4009 (Domain)
 [467-499]  2.6e-07 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit