close all open/close all

CDS information : Aureo_00030


close this sectionLocation

Organism
StrainHKI-227
Entry nameAureothin
Contig
Start / Stop / Direction4,858 / 5,868 / + [in whole cluster]
4,858 / 5,868 / + [in contig]
Location4858..5868 [in whole cluster]
4858..5868 [in contig]
TypeCDS
Length1,011 bp (336 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productpara-aminobenzoate N-oxygenase
Product (GenBank)putative N-oxidase
Gene
Gene (GenBank)aurF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14700630] Iteration as programmed event during polyketide assembly; molecular analysis of the aureothin biosynthesis gene cluster. (Chem Biol. , 2003)
[15038705] Biosynthetic origin of the rare nitroaryl moiety of the polyketide antibiotic aureothin: involvement of an unprecedented N-oxygenase. (J Am Chem Soc. , 2004)
[18458342] In vitro reconstitution and crystal structure of p-aminobenzoate N-oxygenase (AurF) involved in aureothin biosynthesis. (Proc Natl Acad Sci U S A. , 2008)
[20798054] Four-electron oxidation of p-hydroxylaminobenzoate to p-nitrobenzoate by a peroxodiferric complex in AurF from Streptomyces thioluteus. (Proc Natl Acad Sci U S A. , 2010)
[21678538] A ribonucleotide reductase-like electron transfer system in the nitroaryl-forming N-oxygenase AurF. (Chembiochem. , 2011)
[24973817] Characterization of the N-oxygenase AurF from Streptomyces thioletus. (Bioorg Med Chem. , 2014)
[26588098] Computational Examination on the Active Site Structure of a (Peroxo)diiron(III) Intermediate in the Amine Oxygenase AurF. (Inorg Chem. , 2015)

close this sectionSequence

selected fasta
>para-aminobenzoate N-oxygenase [putative N-oxidase]
MREEQPHLATTWAARGWVEEEGIGSATLGRLVRAWPRRAAVVNKADILDEWADYDTLVPD
YPLEIVPFAEHPLFLAAEPHQRQRVLTGMWIGYNERVIATEQLIAEPAFDLVMHGVFPGS
DDPLIRKSVQQAIVDESFHTYMHMLAIDRTRELRKISERPPQPELVTYRRLRRVLADMPE
QWERDIAVLVWGAVAETCINALLALLARDATIQPMHSLITTLHLRDETAHGSIVVEVVRE
LYARMNEQQRRALVRCLPIALEAFAEQDLSALLLELNAAGIRGAEEIVGDLRSTAGGTRL
VRDFSGARKMVEQLGLDDAVDFDFPERPDWSPHTPR
selected fasta
>para-aminobenzoate N-oxygenase [putative N-oxidase]
ATGCGAGAAGAGCAGCCGCACTTGGCAACCACCTGGGCCGCCCGGGGGTGGGTCGAGGAG
GAGGGCATCGGCAGCGCGACCCTGGGCCGGCTGGTGCGCGCCTGGCCACGCCGCGCGGCG
GTGGTCAACAAGGCGGACATCCTGGACGAGTGGGCCGACTACGACACGCTCGTCCCCGAC
TACCCGCTGGAGATCGTGCCGTTCGCCGAGCACCCCCTGTTCCTCGCGGCCGAACCGCAC
CAGCGGCAGCGCGTGTTGACCGGGATGTGGATCGGCTACAACGAGCGCGTCATCGCCACC
GAGCAGCTCATCGCCGAGCCCGCCTTCGACCTCGTGATGCACGGCGTGTTCCCGGGCAGC
GACGACCCGCTCATCCGCAAGAGCGTGCAGCAGGCCATCGTGGACGAGAGCTTCCACACC
TATATGCACATGCTCGCCATCGACCGCACCCGCGAGCTGCGCAAGATCAGCGAACGGCCG
CCGCAGCCCGAACTCGTCACCTACCGGCGGCTGCGCCGGGTCCTGGCGGACATGCCCGAG
CAGTGGGAGCGGGACATCGCCGTCCTCGTCTGGGGCGCGGTGGCCGAGACCTGCATCAAC
GCCCTGCTGGCGCTGCTGGCCCGGGACGCGACCATCCAGCCCATGCACTCCCTGATCACC
ACCCTGCACCTGCGGGACGAGACGGCGCACGGCTCGATCGTCGTCGAGGTCGTCCGCGAG
CTGTACGCCCGGATGAACGAGCAGCAGCGCCGCGCCCTCGTCCGGTGCCTGCCGATCGCG
CTGGAGGCGTTCGCCGAACAGGACCTGTCCGCGCTGCTCCTCGAACTGAACGCGGCGGGC
ATCCGCGGCGCCGAGGAGATCGTGGGGGACCTGCGGTCGACGGCCGGCGGAACGCGGCTC
GTCCGCGACTTCTCCGGCGCCCGGAAGATGGTCGAGCAGCTCGGCCTGGACGACGCCGTC
GACTTCGACTTCCCGGAGCGGCCCGACTGGTCGCCCCACACGCCGCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025859 P-aminobenzoate N-oxygenase AurF (Family)
 [24-316]  1.39999999999997e-83 PF11583
PF11583   AurF
SignalP
 [1-34]  0.112 Signal
Eukaryota   
TMHMM No significant hit