close all open/close all

CDS information : Aureo_00050


close this sectionLocation

Organism
StrainHKI-227
Entry nameAureothin
Contig
Start / Stop / Direction11,811 / 13,832 / + [in whole cluster]
11,811 / 13,832 / + [in contig]
Location11811..13832 [in whole cluster]
11811..13832 [in contig]
TypeCDS
Length2,022 bp (673 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative aminodeoxychorismate synthase
putative 4-amino-4-deoxychorismate synthase
Product (GenBank)PABA synthase
GeneaurG
pabAB
Gene (GenBank)aurG
EC number2.6.1.85
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14700630] Iteration as programmed event during polyketide assembly; molecular analysis of the aureothin biosynthesis gene cluster. (Chem Biol. , 2003)
Related Reference
ACC
P72539
PmId
[9044253] Identification and analysis of genes from Streptomyces pristinaespiralis encoding enzymes involved in the biosynthesis of the 4-dimethylamino-L-phenylalanine precursor of pristinamycin I. (Mol Microbiol. , 1997)
ACC
P32483
PmId
[11782498] The candicidin gene cluster from Streptomyces griseus IMRU 3570. (Microbiology. , 2002)
ACC
Q56151
PmId
[8704974] A role for pabAB, a p-aminobenzoate synthase gene of Streptomyces venezuelae ISP5230, in chloramphenicol biosynthesis. (Microbiology. , 1996)

close this sectionSequence

selected fasta
>putative aminodeoxychorismate synthase [PABA synthase]
MYGKEPTVLVNDDPSWPELDPAMFDCVVVSPGPGRPQHPADLGFCQEVLDRWTDTPVLGV
CLGHQAIAHHHGADVAEGTPKHGHLARVRHGGRDLFDGLPQNFTAVRYHSLRAAEPLPEE
LEATAWAEDGTVMALRHRTLPRWGVQFHPESIASEWGAQLLQNFAKLVGAEYAAAPRERA
RWAAPLEDAPAEAPELRPVFEVIDRAVDTAELFTTLYSASAGCFWLDSSAPGIGPARFSF
LGDDSGPLAETLTYRTGENTVAVRDAAGERAEPGTIFEVLQQRLRDRRLSTPELPFDLNG
GYVGYFGYELKGECGSPNVHRSETPDAVWTFADRLIAVDHLEEKTYVVAVSGTGPGEEDA
ARAWVTETARRARELPDPAPSEAPAPAATAPSEQVDIARDRGQYVSDIKDCLDELHSGES
YEICLTNRIRLPELKDPLGYHLLLRRLNPAPYGAFLRHEGVSVVCSSPERFLRIDRDGVV
ESRPIKGTAPRGEDPAADEALRVSLAASAKTRAENLMIVDLLRNDLGRVCEVGSVDVPAY
MVTETYATVHQLVTTVRGRLRHDVDPVACVRACFPGGSMTGAPKLRTMAIIDRLEQEARG
IYSGTIGYFGLSGAADLNIVIRTAVSTGTGTVIGTGGAIVLDSDPDEEFDEVLLKGHALV
RAHGLLEGAAEAP
selected fasta
>putative aminodeoxychorismate synthase [PABA synthase]
GTGTACGGCAAGGAACCGACGGTCCTCGTCAACGACGACCCGTCGTGGCCGGAGCTGGAC
CCGGCGATGTTCGACTGCGTCGTCGTCTCGCCCGGCCCGGGCCGCCCCCAGCACCCGGCC
GACCTCGGCTTCTGCCAGGAGGTCCTGGACCGCTGGACGGACACCCCGGTCCTCGGGGTG
TGCCTGGGGCACCAGGCGATCGCCCACCACCACGGCGCGGACGTGGCCGAGGGCACGCCG
AAGCACGGTCACCTGGCGCGGGTCCGGCACGGCGGGCGGGACCTCTTCGACGGCCTGCCG
CAGAACTTCACCGCGGTGCGCTACCACTCGCTGCGGGCCGCCGAACCCCTGCCGGAGGAG
CTGGAGGCCACCGCCTGGGCCGAGGACGGCACCGTCATGGCGCTGCGGCACCGCACGCTG
CCCCGCTGGGGCGTGCAGTTCCACCCGGAGTCCATCGCGAGCGAGTGGGGCGCCCAACTG
CTCCAGAACTTCGCGAAGCTCGTCGGCGCCGAGTACGCCGCCGCGCCCCGGGAACGGGCG
CGGTGGGCCGCCCCGTTGGAGGACGCCCCCGCGGAGGCGCCGGAACTGCGGCCCGTGTTC
GAGGTGATCGACCGGGCCGTGGACACCGCGGAGCTGTTCACCACGCTGTACTCCGCGAGC
GCCGGCTGCTTCTGGCTCGACAGCAGCGCGCCGGGGATCGGGCCGGCCCGGTTCTCGTTC
CTCGGGGACGACTCCGGCCCCCTCGCCGAGACGCTGACGTACCGGACCGGGGAGAACACG
GTCGCGGTGCGCGACGCCGCCGGTGAACGGGCCGAGCCCGGCACCATCTTCGAGGTGCTC
CAGCAGCGGCTCCGCGACCGCCGGCTCAGCACGCCGGAGCTGCCCTTCGACCTCAACGGC
GGCTACGTCGGCTACTTCGGCTACGAGCTCAAGGGCGAGTGCGGCAGCCCGAACGTCCAC
CGGTCCGAAACCCCGGACGCCGTCTGGACGTTCGCCGACCGGCTGATCGCGGTGGACCAC
CTGGAAGAGAAGACCTACGTCGTGGCCGTGAGCGGCACCGGGCCGGGCGAGGAGGACGCG
GCCCGGGCCTGGGTGACGGAGACCGCCCGGCGGGCCCGCGAACTGCCGGACCCCGCCCCG
TCCGAGGCACCCGCCCCGGCCGCCACGGCGCCGTCCGAACAGGTCGACATCGCCCGCGAC
CGCGGCCAGTACGTGAGCGACATCAAGGACTGCCTCGACGAGCTGCACAGCGGCGAGAGC
TACGAGATCTGCCTGACCAACCGGATCCGGCTGCCCGAGCTGAAGGACCCGCTCGGCTAC
CACCTCCTGCTCCGGCGCCTCAACCCCGCCCCCTACGGCGCGTTCCTGCGCCACGAGGGC
GTGAGCGTCGTGTGCTCCTCCCCGGAGCGGTTCCTGCGGATCGACCGGGACGGCGTCGTG
GAGAGCCGGCCCATCAAGGGAACGGCCCCCCGGGGCGAGGACCCGGCCGCCGACGAGGCG
CTCCGGGTGTCGCTCGCCGCCTCGGCCAAGACCCGGGCCGAGAACCTCATGATCGTCGAC
CTGCTCCGCAACGACCTGGGCCGGGTGTGCGAGGTCGGTTCCGTCGACGTCCCCGCCTAC
ATGGTCACCGAGACGTACGCGACGGTGCACCAGCTGGTCACCACGGTCCGGGGCCGCCTG
CGGCACGACGTGGACCCGGTCGCCTGCGTCCGGGCCTGCTTCCCCGGCGGCTCGATGACG
GGCGCCCCGAAGCTGCGGACGATGGCCATCATCGACCGCCTGGAGCAGGAGGCCCGCGGC
ATCTACTCCGGCACCATCGGCTACTTCGGGCTCTCCGGCGCCGCGGACCTCAACATCGTC
ATCCGCACCGCCGTCTCCACCGGTACGGGCACGGTCATCGGCACCGGCGGCGCCATCGTC
CTCGACTCGGACCCGGACGAGGAGTTCGACGAGGTGCTGCTCAAGGGCCACGCGCTGGTG
CGGGCGCACGGGCTGCTGGAGGGGGCCGCGGAGGCCCCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005801 ADC synthase (Domain)
 [192-673]  1.7e-122 SSF56322
SSF56322   ADC synthase
 [200-664]  1.5e-139 G3DSA:3.60.120.10
G3DSA:3.60.120.10   no description
IPR005802 Para-aminobenzoate synthase, component I (Family)
 [303-657]  5.5e-105 TIGR00553
TIGR00553   pabB: aminodeoxychorismate synthase, component I
IPR006221 Anthranilate synthase/para-aminobenzoate synthase, glutamine amidotransferase (Family)
 [10-166]  3.1e-36 TIGR00566
TIGR00566   trpG_papA: glutamine amidotransferase of anthrani
IPR006805 Anthranilate synthase component I, N-terminal (Domain)
 [208-347]  8.3e-21 PF04715
PF04715   Anth_synt_I_N
IPR015890 Chorismate binding, C-terminal (Domain)
 [401-655]  1.9e-84 PF00425
PF00425   Chorismate_bind
IPR017926 Glutamine amidotransferase type 1 (Domain)
 [23-164]  4.2e-35 PF00117
PF00117   GATase
 [1-174]  22.336 PS51273
PS51273   GATASE_TYPE_1
SignalP No significant hit
TMHMM No significant hit