close all open/close all

CDS information : Aureo_00060


close this sectionLocation

Organism
StrainHKI-227
Entry nameAureothin
Contig
Start / Stop / Direction13,938 / 15,158 / + [in whole cluster]
13,938 / 15,158 / + [in contig]
Location13938..15158 [in whole cluster]
13938..15158 [in contig]
TypeCDS
Length1,221 bp (406 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)putative cytochrome P450
Gene
Gene (GenBank)aurH
EC number
Keyword
  • furan ring
Note
Note (GenBank)
Reference
ACC
PmId
[14700630] Iteration as programmed event during polyketide assembly; molecular analysis of the aureothin biosynthesis gene cluster. (Chem Biol. , 2003)
[15612710] Formation of the aureothin tetrahydrofuran ring by a bifunctional cytochrome p450 monooxygenase. (J Am Chem Soc. , 2004)
[18690656] Chemoenzymatic total synthesis of the antiproliferative polyketide (+)-(R)-aureothin. (Chembiochem. , 2008)
[18855960] Sequential asymmetric polyketide heterocyclization catalyzed by a single cytochrome P450 monooxygenase (AurH). (Angew Chem Int Ed Engl. , 2008)
[21280577] Structural fine-tuning of a multifunctional cytochrome P450 monooxygenase. (J Am Chem Soc. , 2011)

close this sectionSequence

selected fasta
>cytochrome P450 [putative cytochrome P450]
MSTTAHTEPSWADLPFLDFTDPNFSWDSPEVAEAREKSWIARTPLALLVLRYAEADQLAR
DKRLISGFRGLVDMVGTPEGPVRDFMVDFLQSLDGADHRRLRGLATHPFTPRRITAVQPF
VRSTVEQLIDKLPQGDFDFVQHFPHPLPALVMCQLLGFPLEDYDTVGRLSIETNLGLALS
NDQDILVKVEQGLGRMFDYLVAAIEKRKVEPGDDLTSDIVRAFHDGVLDDYELRTLVATV
LVAGYETTNHQLALAMYDFAQHPDQWMKIKENPELAPQAVEEVLRWSPTLPVTATRVAAE
DFEVNGVRIPTGTPVFMCAHVAHRDPRVFADADRFDITVKREAPSIAFGGGPHFCLGTAL
ARLELTEAVAALATRLDPPQIAGEITWRHELGVAGPDALPLRFGAA
selected fasta
>cytochrome P450 [putative cytochrome P450]
ATGTCGACCACCGCTCACACCGAGCCGTCCTGGGCGGATCTGCCGTTCCTGGACTTCACC
GACCCGAACTTCTCCTGGGACTCCCCGGAGGTGGCCGAGGCCCGCGAGAAGTCCTGGATC
GCCCGGACCCCGCTGGCCCTCCTCGTCCTGCGCTACGCGGAGGCCGACCAACTGGCCCGC
GACAAGCGGCTGATCTCCGGATTCCGCGGCCTGGTCGACATGGTCGGGACCCCGGAGGGC
CCGGTCCGCGACTTCATGGTCGACTTCCTGCAGAGCCTGGACGGCGCGGACCACCGCCGG
CTGCGCGGGCTGGCCACCCACCCCTTCACCCCCCGCCGCATCACCGCGGTGCAGCCCTTC
GTCCGCTCCACCGTCGAGCAGCTCATCGACAAGCTGCCGCAGGGCGATTTCGACTTCGTG
CAGCACTTCCCCCACCCGCTGCCCGCTCTGGTGATGTGCCAGCTGCTGGGCTTCCCGCTG
GAGGACTACGACACCGTCGGCCGGCTGTCCATCGAGACCAACCTCGGCCTGGCGCTCTCC
AACGACCAGGACATCCTCGTCAAGGTCGAGCAGGGCCTCGGCCGCATGTTCGACTACCTG
GTGGCCGCGATCGAGAAGCGCAAGGTCGAGCCCGGCGACGACCTCACCTCCGACATCGTC
CGCGCCTTCCACGACGGCGTCCTCGACGACTACGAGCTGCGCACCCTGGTCGCCACCGTC
CTGGTCGCCGGCTACGAGACCACCAACCACCAACTGGCCCTGGCGATGTACGACTTCGCC
CAGCACCCCGACCAGTGGATGAAGATCAAGGAGAACCCCGAGCTGGCCCCCCAGGCCGTC
GAGGAGGTGCTGCGCTGGAGCCCCACGCTGCCCGTGACGGCCACCCGGGTCGCCGCCGAG
GACTTCGAGGTCAACGGCGTCCGCATCCCCACCGGCACCCCCGTCTTCATGTGCGCCCAC
GTCGCGCACCGCGACCCCCGCGTCTTCGCCGACGCCGACCGCTTCGACATCACCGTCAAG
CGCGAGGCGCCGTCCATCGCCTTCGGCGGCGGCCCGCACTTCTGCCTGGGCACCGCGCTG
GCCCGGCTCGAACTCACCGAGGCCGTCGCGGCGCTGGCCACCCGGCTGGACCCGCCGCAG
ATCGCCGGCGAGATCACCTGGCGGCACGAGCTCGGCGTCGCCGGGCCGGACGCCCTGCCG
CTGCGCTTCGGCGCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [18-403]  3.90000000000001e-90 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [243-260]  1.19999985703101e-07 PR00385 [278-289]  1.19999985703101e-07 PR00385 [346-355]  1.19999985703101e-07 PR00385 [355-366]  1.19999985703101e-07 PR00385
PR00385   P450
 [27-403]  1.09999184471405e-81 SSF48264
SSF48264   Cytochrome_P450
 [194-370]  2.4e-25 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [93-104]  1.99999636034521e-43 PR00359 [138-154]  1.99999636034521e-43 PR00359 [155-170]  1.99999636034521e-43 PR00359 [198-220]  1.99999636034521e-43 PR00359 [278-289]  1.99999636034521e-43 PR00359 [296-323]  1.99999636034521e-43 PR00359 [324-339]  1.99999636034521e-43 PR00359 [346-355]  1.99999636034521e-43 PR00359 [355-366]  1.99999636034521e-43 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [348-357]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-55]  0.063 Signal
Eukaryota   
 [1-12]  0.07 Signal
Bacteria, Gram-negative   
 [1-34]  0.074 Signal
Bacteria, Gram-positive   
TMHMM No significant hit