close all open/close all

CDS information : Aureo_00070


close this sectionLocation

Organism
StrainHKI-227
Entry nameAureothin
Contig
Start / Stop / Direction15,244 / 21,738 / + [in whole cluster]
15,244 / 21,738 / + [in contig]
Location15244..21738 [in whole cluster]
15244..21738 [in contig]
TypeCDS
Length6,495 bp (2,164 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase type I
Gene
Gene (GenBank)aurB
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14700630] Iteration as programmed event during polyketide assembly; molecular analysis of the aureothin biosynthesis gene cluster. (Chem Biol. , 2003)
[15812854] Functional analysis of the aureothin iterative type I polyketide synthase. (Chembiochem. , 2005)

close this sectionPKS/NRPS Module

2 malonyl-CoA
KS34..409
AT564..884
DH932..1096
ER1414..1719
KR1729..1910
ACP2012..2082

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase type I]
MTNDAKTLEYLKRLTAELLETRERLRTAEAADQEPVAVVSMGCRYPGGVSSPEDLWRLVT
DGTDAIAPFPADRGWNVDDLFDPDPDRPGRTYTLEGGFVDGAAEFDADLFGISPREATAM
DPQQRLLLETAWETFERAGTDPGSLRGRPVGVFVGSLFVAGGSGVGVAEGAEGYHMTGNA
ASVLSGRLAYAFGLEGPAVTVDTACSASLVAVHQAVQALRQGECALALAGGSTVMTTPGV
FTEFSRQRGLAPDGRCKAFATAADGTGFGEGVGLVLLEKLSDARKNGHPVLAVIRGSAVN
QDGASNGLTAPNGPSQQRVIRQALAAARVSADEVDVVEAHGTGTGLGDPVEAQALLATYG
QGRPDDRPLWLGSIKSNLGHTQGAAGVAGLIKMVMAVRHGVLPMTLHVDEPSAHVDWDSG
AVRLLTGNHDWPETGRPRRAGVSSFGISGTNAHLILEQAPDAEESDAEPASGAPARIPWV
LAARGEEALRAQAERLLTEVRDRPELRPVDVGHALATSRAALDQRAVVWADGRDGLLAAL
TALAEERPAPGVVHGTVADGRLAFLFSGQGSQRPGMGHELTESFPVFAEKLDEVCGHLDR
HLDRPLRELLFAAEGTPEAALLEQTGYTQAALFAHEVALHHLLTHWGITPDLLLGHSIGE
LTAAHVAGVLSLEDACALVAARGRLMQQLPGAGAMLSVQATEAEVLPWVTEHAHEMSIAA
VNGPRSVVVSGAESAVLEFAEHWKNEGRKTKRLRVSHAFHSPQMDGMLQEFARVAEKLAF
HPPRIPVVSNVTGEVATAEQLCSPAYWVRHAREAVRFHDGIRRLVAEGAHVFLEVGPSGV
LTAMAQDCLADEPGTVTAAVSRGGRPEADAALAAVAEAYVHGVRVDWDRFFAGTGARRID
LPTYAFRRRSFPWIQAAPDADVTTAGLAGLGHPLLGASLELADAQGAALSGRLSARTESW
LADHVVLGSTLVPGTAVVEMAVRAGAETGCGRLAELTQEAPLAVPERGAVHLQVRVGPAG
EQGHRPVGVYSRPEDAEPDEPWACHARGVLAPEAAPVPAGTGGAWPPSGAEPVPLDGFYE
RLAAEGFAYGPAFQGLTRAWRLGDEVLAEITLPEGACSGADRYGVHPALLDAALHTALLK
EEASDTSQVRIPFAWHEVSFHGGSAPVLRARLTPSGTDTVSLALWDEHGTPVASVGSLVS
RPVSARQLRATRTHDTLFRLDWVETTITPAAARCAVLGDDELAGALSVPAFADLAALESA
DPVPELVLYPCLGDDAEDDRADAARSLTARVLGVLQAWVADERWATTRLALVTRGAMSVT
DREQVTDLPAAAVWGLVRSAQAEHPGRFVLADLDGDTASAAALPGILAASGDEPQLALRE
GAVLVPRLARGVPSGTLVPPPGTRDWHLELTGGGTVDDLALTPFPEAAAPLAPGQVRVAV
RAAGLNFRDVVMALGMVDDRRALGGEIAGIVTEAGPGVTGFAPGDRVFGLADGCIGPVAV
VDHRLIARIPEGWSFPQAASVPVTFLTAYYGLVDLAGVRPGDRVLVHAAAGGVGMAAVQL
ARHLGAEVFATAGPAKWDTVRALGIDDDHLASSRTDEFETRFAAEDGGRGIDVVLNSLAG
EMADASLRLVRPGGRFIEMGKTDIRDADEVAAAYEGVVYRAFDLMDGGAECIARIFAELL
ALFEGGKIQLVPVTTWDVRQAPEAFRYFAQARHVGKIVLTVPPAWDPEGTVLVTGASGGV
AAHLVRHLVRTHDVRHLLLASRRGPDAEGMDELIAELRESGAHSVRAVACDCVDRTAVAD
LLASIPDEHPLTAVVHTVGVVDDGVLETMTPERIDAVFRPKADGAWHLHELTRDRDLAAF
AVCSSVAGTLGSAAQANYAAANAFLDALAAHRRDHGLPATSLAWGMWAGTGGMAANLSRA
DLDRMQRSGISGLSTEEGLALFDAALAAGRPVWLPARLDAKALRTAAGGGSLPAPLRGLV
HVPAADAGPLPAADALRGRLASLAPEERHEAVLDVVRAQVAVVLGHGAPEGIDPQRAFKD
LGFDSLTAVELRNRLNAAAGLTLPATLVFDHPTPAALTDHIESVLLAGLGSPADPLLARL
DDWAAGLAATALDDDERERVAARLRALAGQWGAPDDGATSIADELDGATDDEVLDFISNE
LGIS
selected fasta
>polyketide synthase [polyketide synthase type I]
ATGACCAATGACGCCAAGACGCTCGAATACCTCAAGCGCCTCACCGCCGAGCTGTTGGAG
ACCCGTGAACGCCTGCGCACCGCGGAGGCCGCGGACCAGGAGCCCGTCGCGGTGGTGTCA
ATGGGATGTCGCTACCCCGGCGGCGTGTCCTCCCCGGAGGACCTGTGGCGGCTGGTGACC
GACGGGACCGACGCGATCGCGCCGTTCCCGGCCGACCGGGGCTGGAACGTCGACGACCTC
TTCGATCCGGACCCCGACCGGCCCGGCCGGACGTACACCCTCGAAGGCGGATTCGTCGAC
GGCGCCGCCGAGTTCGACGCGGACCTCTTCGGGATCAGCCCGCGCGAGGCCACCGCGATG
GACCCCCAGCAGCGGCTGCTGCTGGAGACCGCGTGGGAGACCTTCGAGCGGGCGGGAACC
GACCCCGGCTCCCTGCGCGGCCGGCCCGTGGGCGTCTTCGTCGGCTCCCTCTTCGTGGCC
GGCGGCAGCGGCGTCGGGGTGGCCGAGGGCGCCGAGGGCTACCACATGACCGGCAACGCG
GCCAGCGTGCTGTCGGGGCGCCTGGCCTACGCGTTCGGCCTCGAAGGCCCCGCCGTCACC
GTGGACACCGCCTGCTCGGCGTCCCTGGTGGCGGTCCACCAGGCCGTCCAGGCCCTGCGG
CAGGGCGAGTGCGCCCTGGCGCTGGCCGGCGGGTCCACGGTGATGACGACCCCGGGCGTC
TTCACCGAGTTCAGCCGGCAGCGCGGGCTGGCCCCCGACGGCCGGTGCAAGGCGTTCGCC
ACGGCGGCGGACGGGACCGGCTTCGGCGAGGGCGTCGGCCTCGTGCTGCTGGAGAAGCTG
TCCGACGCGCGGAAGAACGGGCACCCGGTACTGGCCGTCATCCGCGGCTCCGCGGTCAAC
CAGGACGGCGCCTCCAACGGCCTCACCGCGCCCAACGGGCCGTCCCAGCAGCGCGTCATC
CGGCAGGCGCTGGCCGCCGCCCGCGTGTCGGCCGACGAGGTCGACGTCGTGGAGGCGCAC
GGCACGGGCACCGGCCTGGGCGACCCCGTCGAGGCCCAGGCCCTGCTGGCCACCTACGGC
CAGGGCCGCCCGGACGACCGGCCGCTGTGGCTGGGATCGATCAAGTCGAACCTGGGGCAC
ACCCAGGGCGCGGCGGGCGTCGCCGGCCTGATCAAGATGGTCATGGCGGTACGGCACGGC
GTCCTCCCGATGACCCTGCACGTCGACGAGCCCTCCGCACACGTGGACTGGGACTCCGGC
GCCGTCCGGCTGCTGACCGGCAACCACGACTGGCCGGAGACCGGTCGCCCGCGCCGGGCG
GGCGTCTCGTCGTTCGGCATCAGCGGGACCAACGCCCACCTGATCCTCGAACAGGCCCCC
GATGCGGAGGAGTCGGACGCGGAGCCCGCGTCCGGCGCGCCCGCACGCATCCCATGGGTG
CTCGCCGCCCGCGGCGAGGAGGCCCTGCGGGCCCAGGCCGAGCGGCTGCTGACCGAGGTC
CGGGACCGCCCGGAGCTGCGCCCGGTGGACGTCGGCCATGCGCTGGCGACCTCCCGCGCG
GCCCTCGACCAGCGGGCCGTGGTGTGGGCCGACGGCCGCGACGGCCTCCTCGCCGCGCTG
ACGGCGCTGGCCGAGGAGCGTCCCGCCCCCGGCGTCGTCCACGGCACGGTGGCCGACGGC
CGCCTGGCCTTCCTCTTCTCCGGCCAGGGCAGCCAACGCCCCGGCATGGGACACGAGTTG
ACCGAGAGCTTCCCGGTCTTCGCCGAGAAGCTCGACGAGGTCTGCGGCCATCTGGACCGG
CACCTGGACCGGCCGCTGCGGGAGCTGCTGTTCGCCGCCGAGGGAACGCCCGAGGCCGCG
CTGCTGGAGCAGACCGGCTACACCCAGGCCGCGCTCTTCGCCCACGAGGTGGCCCTGCAC
CACCTGCTCACCCACTGGGGGATCACCCCCGACCTGCTGCTCGGCCACTCCATCGGCGAG
CTGACGGCCGCACACGTCGCCGGCGTCCTGTCGCTGGAGGACGCGTGCGCCCTCGTCGCC
GCCCGCGGCCGGCTGATGCAGCAACTGCCCGGCGCCGGCGCCATGCTCTCGGTGCAGGCC
ACCGAGGCCGAGGTCCTCCCGTGGGTGACCGAGCACGCGCACGAGATGTCGATCGCCGCC
GTGAACGGACCCCGGTCCGTGGTGGTGTCCGGCGCCGAGTCCGCCGTCCTGGAGTTCGCC
GAGCACTGGAAGAACGAGGGGCGCAAGACCAAACGGCTGCGCGTGAGCCACGCCTTCCAC
TCCCCGCAGATGGACGGCATGCTCCAGGAGTTCGCCCGGGTGGCCGAGAAGCTCGCCTTC
CACCCGCCCCGGATCCCCGTCGTCTCCAACGTCACCGGCGAGGTCGCCACCGCCGAGCAG
CTGTGCTCGCCGGCGTACTGGGTGCGCCACGCCCGCGAGGCGGTGCGCTTCCACGACGGG
ATCCGCCGGCTCGTGGCGGAAGGGGCGCACGTGTTCCTGGAGGTCGGACCCTCCGGGGTG
CTGACGGCCATGGCCCAGGACTGCCTCGCCGACGAACCGGGCACGGTGACCGCCGCGGTG
TCGCGCGGCGGCCGCCCCGAGGCCGACGCCGCGCTCGCCGCGGTGGCCGAGGCGTACGTC
CACGGCGTGCGGGTCGACTGGGACCGCTTCTTCGCGGGCACCGGCGCCCGCAGGATCGAC
CTGCCCACCTACGCCTTCCGGCGCCGCAGTTTCCCCTGGATCCAGGCGGCCCCGGACGCC
GACGTCACGACGGCCGGCCTCGCCGGGCTCGGACACCCGCTGCTCGGCGCCTCGTTGGAG
CTCGCGGACGCGCAGGGCGCCGCCCTCAGCGGGCGCCTGTCGGCGCGGACCGAGTCCTGG
CTGGCCGACCACGTCGTGCTCGGCTCCACGCTCGTCCCGGGCACCGCCGTCGTCGAGATG
GCCGTCCGCGCCGGCGCCGAGACCGGCTGCGGGCGCCTCGCCGAGCTGACCCAGGAGGCC
CCGCTGGCCGTACCCGAGCGGGGCGCCGTGCACCTCCAGGTGCGGGTCGGCCCGGCGGGG
GAGCAGGGGCACCGCCCGGTGGGCGTGTACTCCCGGCCCGAGGACGCCGAACCGGACGAG
CCCTGGGCCTGCCACGCCCGCGGCGTCCTCGCCCCCGAGGCCGCCCCCGTCCCGGCCGGC
ACCGGCGGGGCATGGCCGCCCTCCGGCGCCGAACCGGTCCCGCTCGACGGCTTCTACGAG
CGCCTGGCCGCCGAGGGCTTCGCCTACGGCCCCGCCTTCCAAGGGCTGACCCGGGCCTGG
CGGCTCGGCGACGAGGTGCTCGCGGAGATCACCCTCCCCGAGGGCGCATGCTCCGGCGCC
GACCGCTACGGCGTCCACCCCGCGCTCCTCGACGCCGCACTGCACACCGCCCTCCTGAAG
GAGGAGGCGTCCGACACGTCGCAGGTGCGCATCCCGTTCGCCTGGCACGAGGTGTCCTTC
CACGGCGGCAGCGCGCCGGTGCTGCGCGCCCGGCTGACCCCGAGCGGCACGGACACGGTG
TCCCTCGCCCTGTGGGACGAGCACGGCACGCCCGTGGCGTCGGTCGGATCGCTGGTGAGC
CGCCCCGTCTCCGCCCGGCAACTCCGGGCCACCCGTACCCACGACACCCTGTTCCGCCTC
GACTGGGTGGAGACCACGATCACCCCGGCGGCCGCGCGCTGCGCCGTCCTGGGCGACGAC
GAGTTGGCGGGCGCGCTGTCGGTCCCGGCCTTCGCGGATCTCGCCGCGCTCGAATCCGCC
GATCCCGTACCGGAGTTGGTCCTCTACCCCTGCCTCGGCGATGACGCCGAGGACGACCGG
GCGGACGCCGCCCGTTCCCTCACCGCCCGCGTCCTCGGCGTGCTCCAGGCGTGGGTCGCC
GACGAGCGGTGGGCCACCACCCGCCTGGCCCTGGTCACCCGGGGCGCGATGTCCGTCACC
GACCGGGAGCAGGTCACCGATCTGCCCGCCGCCGCCGTCTGGGGCCTGGTGCGCTCCGCG
CAGGCCGAGCACCCGGGGCGGTTCGTCCTGGCCGACCTGGACGGGGACACCGCCTCCGCG
GCGGCCCTGCCCGGAATCCTGGCCGCCTCCGGCGACGAGCCCCAACTCGCCCTCCGCGAA
GGGGCGGTGCTGGTGCCGAGGCTGGCCCGCGGCGTCCCGTCGGGCACCCTCGTGCCGCCG
CCGGGGACCCGGGACTGGCACCTGGAACTGACCGGCGGGGGCACCGTCGACGACCTGGCC
CTCACCCCGTTCCCCGAGGCCGCCGCCCCGCTTGCGCCCGGACAGGTCCGGGTCGCGGTC
CGCGCGGCCGGGCTGAACTTCCGCGACGTCGTCATGGCCCTGGGCATGGTCGACGACCGG
CGGGCCCTGGGCGGCGAGATCGCGGGCATCGTCACCGAGGCCGGGCCGGGCGTCACCGGA
TTCGCCCCGGGCGACCGGGTGTTCGGGCTCGCGGACGGCTGCATCGGCCCCGTCGCGGTC
GTCGACCACCGCCTGATCGCCCGCATCCCGGAGGGCTGGTCCTTCCCGCAGGCCGCCTCC
GTCCCCGTCACCTTCCTCACCGCCTACTACGGCCTGGTGGACCTCGCTGGGGTCCGGCCC
GGGGACCGCGTGCTGGTGCACGCGGCGGCGGGCGGCGTCGGCATGGCCGCCGTCCAGCTC
GCCCGGCACCTGGGGGCCGAGGTGTTCGCGACGGCCGGTCCCGCCAAGTGGGACACCGTG
CGCGCCCTGGGCATCGACGACGACCACCTCGCCTCCTCGCGCACCGACGAGTTCGAGACC
CGCTTCGCCGCCGAGGACGGCGGCCGGGGCATCGACGTCGTCCTCAACTCCCTCGCCGGG
GAGATGGCGGACGCCTCGCTGCGCCTGGTGCGGCCGGGCGGCCGGTTCATCGAGATGGGC
AAGACCGACATCCGCGACGCCGACGAGGTCGCCGCCGCCTACGAGGGCGTCGTCTACCGG
GCGTTCGACCTGATGGACGGCGGGGCCGAGTGCATCGCCCGGATCTTCGCGGAACTCCTC
GCCCTGTTCGAGGGCGGGAAGATCCAGCTGGTCCCGGTGACCACCTGGGACGTCCGGCAG
GCGCCCGAGGCCTTCCGCTACTTCGCCCAGGCGCGCCACGTCGGCAAGATCGTCCTCACG
GTGCCGCCCGCCTGGGACCCCGAGGGGACCGTCCTGGTGACCGGCGCCTCCGGGGGCGTC
GCCGCGCACCTGGTCCGCCACCTGGTCCGCACCCACGACGTACGGCACCTGCTGCTCGCC
AGCCGCCGCGGCCCCGACGCCGAGGGCATGGACGAACTCATCGCCGAACTGCGGGAGTCG
GGCGCACACTCGGTCCGGGCCGTGGCCTGCGACTGCGTCGACCGCACCGCGGTCGCGGAC
CTGCTGGCGTCCATCCCCGACGAGCACCCGCTGACCGCCGTCGTGCACACCGTCGGAGTC
GTCGACGACGGCGTCCTGGAGACGATGACGCCCGAGCGCATCGACGCGGTCTTCCGGCCC
AAGGCCGACGGCGCCTGGCACCTCCACGAGCTGACCCGCGACCGGGACCTCGCCGCCTTC
GCCGTCTGCTCCTCCGTCGCGGGCACCCTCGGCTCGGCCGCCCAGGCCAACTACGCGGCC
GCCAACGCCTTCCTCGACGCCCTGGCCGCCCACCGCCGCGACCACGGCCTGCCCGCCACC
TCCCTCGCCTGGGGCATGTGGGCCGGCACCGGCGGCATGGCCGCCAACCTCTCCCGGGCC
GACCTGGACCGCATGCAGCGCTCCGGCATCAGCGGCCTGTCCACCGAGGAGGGCCTCGCC
CTCTTCGACGCGGCGCTGGCGGCAGGGCGTCCGGTGTGGCTCCCGGCCCGGCTCGACGCC
AAGGCCCTGCGCACCGCCGCCGGGGGCGGATCCCTCCCGGCCCCGCTGCGCGGCCTCGTC
CACGTCCCCGCCGCGGACGCCGGACCGCTCCCGGCCGCGGACGCGCTGCGCGGACGCCTG
GCGTCGCTCGCGCCCGAGGAGCGCCACGAGGCCGTCCTGGACGTGGTGCGCGCCCAGGTC
GCCGTCGTCCTCGGCCACGGGGCGCCCGAGGGCATCGACCCCCAACGCGCCTTCAAGGAC
CTCGGGTTCGACTCGCTCACCGCCGTCGAACTGCGCAACCGCCTCAACGCGGCGGCCGGT
CTGACCCTGCCCGCCACGCTGGTGTTCGACCACCCGACACCGGCCGCCCTGACCGACCAC
ATCGAGAGCGTCCTCCTGGCCGGCCTCGGCTCCCCGGCCGACCCCCTCCTCGCCCGCCTC
GACGACTGGGCCGCGGGCCTCGCCGCGACCGCGCTCGACGACGACGAGCGCGAGCGGGTG
GCGGCCCGGCTGCGCGCGCTCGCCGGTCAGTGGGGCGCACCGGACGACGGCGCGACGAGC
ATCGCCGACGAGCTCGACGGGGCGACCGACGACGAAGTCCTCGACTTCATCAGCAATGAA
CTCGGCATCTCCTGA
[2] KS34..409
[2] AT564..884
[2] malonyl-CoA757..761
[2] DH932..1096
[2] ER1414..1719
[2] KR1729..1910
[2] ACP2012..2082
[2] KS100..1227
[2] AT1690..2652
[2] malonyl-CoA2269..2283
[2] DH2794..3288
[2] ER4240..5157
[2] KR5185..5730
[2] ACP6034..6246

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [560-689]  3.10000000000005e-79 G3DSA:3.40.366.10 [757-872]  3.10000000000005e-79 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [1541-1562]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [2040-2055]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2010-2083]  4.29999999999998e-24 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [2012-2082]  PS50075
PS50075   ACP_DOMAIN
 [2004-2099]  1.29999924468179e-24 SSF47336
SSF47336   ACP_like
 [2015-2081]  3e-13 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [1403-1550]  4.90001027782405e-31 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1552-1645]  3.2e-18 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1433-1488]  8.00000000000001e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1729-1909]  2.50000000000001e-61 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-283]  3.70000000000004e-92 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [291-409]  9.09999999999992e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [564-884]  1.80000000000002e-64 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-26]  2.9e-08 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [561-862]  3.79997359309398e-72 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [691-756]  9.59999914716171e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-295]  4.80000000000003e-84 G3DSA:3.40.47.10 [296-462]  2.99999999999998e-65 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-407]  8.29994113369276e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1505-1695]  1e-52 G3DSA:3.40.50.720 [1730-1917]  1.80000000000002e-35 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [196-212]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [565-864]  7.19996395544006e-128 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2013-2085]  3.89999861795218e-37 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [932-1096]  1.79999754022378e-79 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-461]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1729-1910]  5.20000089003336e-53 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1414-1719]  SM00829
SM00829   PKS_ER
SignalP
 [1-30]  0.149 Signal
Bacteria, Gram-positive   
 [1-30]  0.086 Signal
Eukaryota   
TMHMM No significant hit