close all open/close all

CDS information : Aureo_00080


close this sectionLocation

Organism
StrainHKI-227
Entry nameAureothin
Contig
Start / Stop / Direction21,801 / 28,406 / + [in whole cluster]
21,801 / 28,406 / + [in contig]
Location21801..28406 [in whole cluster]
21801..28406 [in contig]
TypeCDS
Length6,606 bp (2,201 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase type I
Gene
Gene (GenBank)aurC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14700630] Iteration as programmed event during polyketide assembly; molecular analysis of the aureothin biosynthesis gene cluster. (Chem Biol. , 2003)
[15812854] Functional analysis of the aureothin iterative type I polyketide synthase. (Chembiochem. , 2005)

close this sectionPKS/NRPS Module

3 methylmalonyl-CoA
4
KS34..408
AT572..892
ACP964..1034
KS1056..1434
at1598..1694
ACP1843..1913
TE1987..2197

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase type I]
MATDDKIRYFLKKVTADLHETRGRLKELEDAAAEPIAVVAMGCRFPGDVRSPEDLWRVVV
TGQDAVTPFPEDRGWDLDGLYDADPDRPGTTYAKEGGFLADVASFDAGLFGVSPREALAL
DPQQRLLLEVTWETFERAGITPSSLRGSRTGVFVGTSSQEYAYLVRDSAENLEGYSTGFL
ACVLSGRLAYTFGLEGPAVTVDTGCSASLVAMHQAVQALRAGECGMALAGGAAVMATPGM
FVEFSRQRGMAADGRCKAFSAAADGTGWGEGIGMVLLEKLSDARKNGHPVLAVIRGSAVN
QDGASNGLTAPNGPSQQRVIRAALANARLAASDVDAVEAHGTGTSLGDPIEAQALLATYG
QDRTDGEPLWLGSLKSNIGHTQAAAGVGGVIKMIMALRKGVLPPTLHAGERTPHVDWSSG
AVELLTEARDWPGTGRPRRAGVSSFGISGTNAHLILEQATEEPAGESAEGPAGEPAEPVR
TDAPWPWAISARNARGLREQAARLRHHAFDHPELAPHDVGHSLLASRTLFDHRAVVLGAD
RDDYLNGLAALAEGRSAPGVVEGVAADAGKPVFVFPGQGSQWIGMAAELYRDSTVFRDTL
HECAAAVEPHVDFSLVDVVCGTEDPAILDRVDVVQPALWAMMVSLSALWRSYGVEPGAVV
GHSQGEIAAAVVAGALSLEHGAQIVALRSQLVAKRLSGRGGMAFLALPADRARERLATWG
PRLSVAAVNSPSSVVVSGEPEALDELLAAAEDEGVRAIRVAVDYASHSAHVESLEAELAP
LLAGITPRTAKIPFFSTVTGAQLDTAGLDAAYWYRNLRQTVHFDPAVRGLVAAGHRTYIE
MSPHPVIAVSVEEVLDDTATDGVVLASLRRNEGHVQRFLTSVAEAHVRGVQVDWSDRLGP
RRRVVDLPTHAFQQRRYWLEAGPTRQHTASVQQSAGEEETTETASTDFRRRLAGLPATER
ERLVLETVCEHAAVVLNLSSAAELDVARPFTDLGFVSMTAMELRNRLDAATGVRLSPAAA
FDHPTPEKLSAHLLGHLTDTDDRPAEPAARTTPVADEPIAIVAMGCRYAGDVSSPEQLWD
LVASGRDAVSSMPRNRGWDVEGLYDPQPGQLGRTYVNRGGFLRDADQFDPLLFGISPREA
LAMDPQQRHLLEVAWEVFERARMSPESVRGSRTGVFVGIAGQDYLPLMKTAPEEDGAGHL
MTGTSTSVASGRIAYTFGLEGPAITVDTACSSSLVALHLAVQALRQGDCTSALVAGATIL
STPGAFVEFSQAGGLAVDGRCKAFAASADGTGWGEGVGAILVEPLSEARRHGHPVLALIR
GTATNQDGASNGLSAPNGTAQRRVIRQALANAGLTSRDVDAVEAHGTGTTLGDPIEAEAL
LATYGQDRPAHAPLWLGSLKSNVGHTAAAAGVGGVIKMVMALRNGILPPTLHVDDPTPHV
DWSSGGVELLTEAREWPDSGRARRAGVSAFGISGTNAHVILEAAPDDEPEASEPTAVATL
PSVPWVLSGRTEQALRDQADRLRRFVEERPELEQADVARSLAATRAGLDHRAVILGAGRE
ETLAALTLLAEGGEAPNLVRGTTRSRATVAFHFADGTGIGRRLYPLVPAFAEAVNEVAAA
FAIHLGRPLGEILEPGEDPVLLRATSFTEQVALYRLLEHWGVTPAFVHGRADGEVAAAHC
AGALSLTDAVTLVAAPDTDITTLAIQAPTIPLVSDRTGRPVTPEELRSPEHWARPEHEDG
LRWLASEGVHDVLRIAPADESELLASLAHLHVKGVAVGWATMLTDAGAKPAELPTYAFQH
ERYWPELAGISAREQSRTGSTDQGREFREQLAAAPEDARAEIVAGRVRELVAKVLRLADA
ASVDDETPLPELGFDSLTAVDLRNRLGADLGLRLPPSLVFQHPTVTALARHLTGQWTPTE
TTPEEPAAEAPSTLAPLFARAGELGRGEAFQELVLRVAEFRPTFDAPEERFRVPHVRLAR
GAADSAKLICFPTFAGGSGAHQYARLAAVSGGERDIWVLPAPGFTWQESLPASVETLARL
QADSVEACADGGPVVLLGYSAGGWIAQATATALQERGIAPAAVVLLDSHRPDSAMLPHLH
AHIDGAREDVLWTAGTGDDAYLTAMAHYAHLFHTWTPKETGTPTLLVRASDRPFDEAPTD
WQPHWPLPHTAVDTAGTHFSIIREHSGPTLQAVHAWLDGLH
selected fasta
>polyketide synthase [polyketide synthase type I]
ATGGCTACGGACGACAAGATCCGCTACTTCCTCAAGAAGGTGACGGCCGACCTCCACGAG
ACGCGCGGCCGTCTCAAGGAACTGGAGGACGCCGCCGCGGAACCGATCGCGGTGGTGGCG
ATGGGCTGCCGCTTCCCGGGGGACGTGCGCTCCCCGGAGGACCTGTGGCGCGTGGTCGTC
ACCGGACAGGACGCGGTGACGCCCTTTCCCGAGGACCGCGGCTGGGACCTGGACGGCCTC
TACGACGCCGATCCGGACCGGCCCGGCACGACGTACGCGAAGGAGGGCGGCTTCCTCGCC
GACGTCGCGTCCTTCGACGCGGGCCTGTTCGGCGTGAGCCCGCGCGAGGCGCTCGCCCTG
GACCCGCAGCAGCGCCTGTTGCTGGAGGTGACCTGGGAGACCTTCGAACGCGCCGGCATC
ACCCCGTCCTCCCTGCGCGGCAGCCGCACCGGCGTCTTCGTCGGCACCAGCAGCCAGGAG
TACGCCTACCTGGTCCGCGACTCCGCGGAGAACCTGGAGGGCTACTCGACGGGCTTCCTC
GCCTGCGTCCTCTCCGGCCGCCTCGCCTACACCTTCGGCCTCGAAGGACCCGCGGTCACC
GTCGACACCGGCTGCTCCGCCTCCCTCGTCGCCATGCACCAGGCCGTCCAGGCCCTGCGC
GCCGGCGAGTGCGGCATGGCCCTGGCCGGCGGAGCGGCGGTCATGGCGACCCCGGGCATG
TTCGTCGAGTTCAGCCGGCAGCGCGGCATGGCGGCGGACGGCCGCTGCAAGGCGTTCTCC
GCGGCGGCCGACGGCACCGGCTGGGGCGAAGGCATCGGCATGGTGCTGCTGGAGAAGCTC
TCGGACGCCCGGAAGAACGGGCATCCGGTACTGGCCGTCATCCGCGGTTCCGCGGTCAAC
CAGGACGGCGCCTCCAACGGCCTCACCGCCCCCAACGGCCCCTCCCAGCAACGGGTGATA
CGGGCCGCCCTGGCCAACGCGCGACTCGCGGCGTCCGACGTCGACGCCGTCGAGGCCCAC
GGCACCGGCACCTCCCTCGGCGACCCCATCGAGGCCCAGGCCCTGCTGGCGACGTATGGC
CAGGACCGGACCGACGGGGAACCCCTGTGGCTCGGGTCGCTGAAGTCCAACATCGGCCAC
ACCCAGGCGGCCGCGGGCGTCGGCGGCGTCATCAAAATGATCATGGCGCTGCGCAAGGGC
GTCCTGCCGCCCACCCTGCACGCCGGCGAGCGCACCCCGCACGTCGACTGGTCCTCGGGC
GCCGTCGAGCTGCTGACCGAGGCGCGCGACTGGCCGGGCACCGGCCGCCCGCGCCGCGCC
GGCGTCTCCTCCTTCGGCATCAGCGGCACCAACGCCCACCTGATCCTGGAACAGGCCACC
GAGGAGCCGGCGGGAGAGTCGGCCGAGGGGCCGGCCGGCGAACCGGCCGAGCCGGTACGC
ACCGACGCCCCCTGGCCCTGGGCGATCTCCGCCCGCAACGCCCGCGGCCTCCGGGAACAG
GCCGCCCGCCTGCGCCACCACGCCTTCGACCACCCGGAACTCGCCCCGCACGACGTCGGC
CACTCCCTCCTGGCCTCCCGCACCCTCTTCGACCACCGCGCCGTCGTCCTCGGCGCGGAC
CGGGACGACTACCTCAACGGCCTCGCCGCCCTCGCCGAGGGCAGGAGCGCCCCCGGCGTC
GTCGAAGGCGTCGCCGCGGACGCGGGCAAGCCCGTCTTCGTCTTCCCCGGCCAGGGATCC
CAATGGATCGGCATGGCGGCCGAGTTGTACCGCGACTCCACCGTCTTCCGGGACACGCTC
CACGAGTGCGCCGCCGCCGTCGAACCCCACGTCGACTTCTCCCTCGTGGACGTCGTCTGC
GGCACCGAGGACCCCGCGATCCTGGACCGCGTCGACGTCGTCCAGCCCGCCCTGTGGGCC
ATGATGGTCTCCCTCTCCGCCCTCTGGCGGTCCTACGGCGTCGAGCCCGGCGCCGTCGTC
GGCCACTCCCAGGGCGAGATCGCCGCCGCCGTCGTCGCGGGCGCCCTCTCCCTCGAACAC
GGCGCCCAGATCGTCGCGTTGCGGTCCCAGCTCGTCGCCAAACGCCTCTCCGGCCGCGGC
GGCATGGCCTTCCTCGCCCTGCCCGCCGACCGCGCCCGCGAACGCCTCGCGACCTGGGGC
CCGCGCCTCTCCGTCGCCGCCGTCAACAGCCCCTCGTCGGTGGTCGTTTCGGGCGAACCC
GAAGCCCTCGACGAACTGCTGGCCGCCGCCGAGGATGAAGGCGTACGAGCCATCCGCGTC
GCGGTCGACTACGCCTCCCACTCCGCGCACGTCGAATCCCTGGAGGCCGAACTCGCCCCG
CTGCTCGCCGGAATCACCCCGCGGACGGCGAAGATCCCCTTCTTCTCGACCGTCACCGGC
GCCCAGCTCGACACCGCCGGCCTCGACGCCGCCTACTGGTACCGCAACCTGCGCCAGACC
GTCCACTTCGACCCCGCCGTGCGCGGGCTCGTCGCGGCCGGACACCGCACCTACATCGAG
ATGAGCCCGCACCCGGTCATCGCGGTGTCGGTCGAAGAGGTCCTGGACGACACCGCCACG
GACGGCGTCGTCCTCGCCTCCCTGCGCCGCAACGAAGGACATGTCCAGCGCTTCCTGACC
TCCGTCGCCGAGGCCCACGTACGCGGCGTCCAGGTCGACTGGTCGGACCGCCTCGGCCCG
CGCCGCCGCGTGGTGGACCTCCCCACGCACGCCTTCCAGCAACGCCGGTACTGGCTGGAG
GCGGGGCCGACCCGCCAACACACGGCTTCCGTACAGCAGTCCGCGGGGGAGGAGGAGACC
ACCGAGACCGCCTCCACCGACTTCCGGCGACGCCTGGCCGGCCTCCCCGCGACCGAACGG
GAACGCCTGGTGCTGGAAACGGTCTGCGAGCACGCGGCCGTGGTCCTGAACCTGTCCTCC
GCGGCGGAGCTCGACGTCGCCAGGCCCTTCACCGACCTCGGGTTCGTCTCGATGACGGCG
ATGGAACTGCGCAACCGGCTCGACGCCGCGACCGGCGTCCGCCTCTCCCCGGCGGCGGCC
TTCGACCACCCGACCCCCGAGAAGCTCTCCGCCCACCTCCTGGGTCACCTGACGGACACC
GACGACCGCCCCGCCGAACCGGCCGCGCGGACCACGCCCGTCGCCGACGAGCCGATCGCC
ATCGTCGCCATGGGCTGCCGCTACGCCGGCGACGTGTCCTCCCCCGAACAGCTCTGGGAC
CTGGTCGCCTCGGGACGCGACGCCGTCTCGTCCATGCCGCGCAACCGCGGCTGGGACGTC
GAGGGCCTCTACGACCCGCAGCCGGGGCAGCTCGGACGCACCTACGTCAACCGCGGCGGC
TTCCTGCGCGACGCCGACCAGTTCGACCCGCTCCTCTTCGGCATCAGCCCCCGCGAGGCC
CTCGCCATGGACCCGCAGCAGCGCCACCTGCTGGAAGTGGCGTGGGAGGTCTTCGAACGG
GCGCGGATGTCGCCCGAGTCGGTCCGCGGCAGCCGCACCGGCGTCTTCGTCGGCATCGCC
GGCCAGGACTACCTGCCGCTGATGAAGACGGCCCCCGAGGAGGACGGCGCCGGCCACCTG
ATGACGGGCACGTCGACGAGCGTCGCCTCGGGCCGGATCGCCTACACCTTCGGCCTGGAA
GGCCCGGCCATCACGGTCGACACCGCCTGCTCCTCGTCCCTCGTCGCCCTCCACCTGGCG
GTCCAGGCCCTGCGCCAGGGCGACTGCACGTCCGCCCTGGTGGCCGGAGCCACGATCCTC
TCGACCCCGGGCGCGTTCGTGGAGTTCAGCCAGGCCGGCGGACTCGCGGTCGACGGCAGG
TGCAAGGCGTTCGCCGCGTCCGCGGACGGCACCGGCTGGGGCGAGGGCGTCGGCGCGATC
CTCGTGGAACCGCTGTCGGAGGCCCGCCGCCACGGCCACCCCGTCCTGGCACTGATCCGC
GGCACCGCCACCAACCAGGACGGCGCGAGCAACGGCCTCTCCGCCCCCAACGGCACCGCC
CAACGCCGCGTCATCCGCCAGGCCCTGGCCAACGCCGGCCTCACGAGCCGCGACGTCGAC
GCCGTCGAGGCCCATGGCACCGGCACCACCCTCGGCGACCCCATCGAGGCCGAGGCCCTG
CTGGCCACCTACGGACAGGACCGCCCGGCCCACGCCCCCCTGTGGCTGGGTTCGTTGAAG
TCCAACGTCGGCCACACCGCCGCCGCGGCCGGCGTCGGCGGAGTGATCAAGATGGTGATG
GCCCTGCGCAACGGCATCCTGCCGCCCACCCTGCACGTCGACGACCCGACGCCGCACGTG
GACTGGTCGTCCGGCGGCGTGGAACTGCTGACCGAGGCCCGTGAATGGCCCGACAGCGGG
AGGGCGCGCCGGGCCGGCGTCTCGGCCTTCGGCATCAGCGGGACGAACGCGCACGTGATC
CTGGAAGCGGCCCCGGACGACGAGCCCGAAGCGAGCGAGCCGACCGCCGTGGCCACCCTG
CCCTCCGTCCCCTGGGTCCTGTCCGGCCGGACCGAGCAGGCCCTGCGCGACCAGGCGGAC
CGACTGCGCCGCTTCGTGGAGGAGCGCCCCGAACTCGAACAGGCGGACGTGGCCCGCTCG
TTGGCGGCGACCCGGGCCGGACTCGACCACCGCGCCGTGATCCTGGGCGCTGGTCGGGAG
GAAACGCTGGCGGCCCTCACCCTCCTGGCGGAGGGCGGAGAAGCCCCCAACCTGGTGCGG
GGAACGACCCGTTCCCGGGCCACGGTGGCGTTCCACTTCGCGGACGGAACCGGCATCGGA
CGCCGGCTGTACCCGTTGGTCCCCGCCTTCGCCGAGGCGGTCAACGAGGTTGCCGCCGCG
TTCGCCATACACCTCGGCCGTCCGCTCGGGGAGATCCTGGAGCCGGGCGAGGACCCGGTC
CTCCTGCGGGCCACGTCTTTCACCGAACAGGTGGCGCTGTACCGGCTGTTGGAGCACTGG
GGCGTCACCCCGGCCTTCGTCCACGGCCGGGCCGACGGCGAGGTGGCCGCCGCGCACTGC
GCGGGCGCGCTGTCCCTGACCGACGCGGTGACGCTCGTCGCCGCCCCGGACACCGACATC
ACCACCCTGGCGATCCAGGCACCGACGATCCCCCTCGTCTCCGACCGGACCGGCCGCCCC
GTCACGCCGGAGGAGCTGCGCTCCCCGGAGCACTGGGCCCGCCCGGAGCACGAGGACGGC
CTGCGGTGGCTGGCCTCGGAAGGGGTGCACGACGTCCTGCGGATCGCCCCCGCCGACGAG
TCCGAACTCCTCGCCTCACTGGCCCACTTGCATGTGAAGGGCGTAGCGGTGGGCTGGGCG
ACGATGCTCACCGACGCGGGCGCGAAGCCGGCGGAGCTGCCCACGTACGCCTTCCAGCAC
GAGCGGTACTGGCCCGAGCTGGCCGGGATCTCGGCCCGGGAACAGAGCCGCACGGGGAGC
ACGGACCAGGGCCGGGAATTCCGCGAGCAACTGGCCGCGGCACCCGAGGACGCACGCGCG
GAGATCGTCGCGGGCCGCGTCCGCGAACTCGTCGCGAAGGTCCTCAGGCTGGCCGACGCC
GCCTCCGTCGACGACGAAACCCCGCTCCCCGAGCTGGGCTTCGACTCGCTGACCGCGGTG
GACCTGCGCAACCGCCTCGGGGCGGACCTGGGCCTCCGGCTTCCCCCGTCGCTGGTCTTC
CAGCACCCGACCGTCACCGCCCTGGCCCGGCACCTGACCGGACAGTGGACGCCGACGGAG
ACGACACCCGAGGAACCCGCCGCAGAGGCCCCGTCCACCCTGGCCCCCCTCTTCGCCCGC
GCCGGCGAACTGGGCCGGGGGGAGGCCTTCCAGGAACTGGTCCTGCGCGTGGCGGAGTTC
CGCCCCACCTTCGACGCGCCGGAGGAGCGGTTCCGCGTCCCGCACGTCCGCCTGGCCCGC
GGCGCGGCGGACAGCGCGAAACTGATCTGCTTCCCGACCTTCGCAGGAGGCTCAGGAGCA
CACCAGTACGCGCGCCTGGCCGCGGTGTCCGGCGGCGAACGCGACATCTGGGTCCTGCCG
GCCCCCGGCTTCACCTGGCAGGAGTCACTCCCCGCCTCGGTCGAGACGCTGGCCCGCCTG
CAGGCGGACAGCGTCGAGGCATGCGCCGACGGCGGCCCGGTCGTCCTCCTCGGCTACTCG
GCGGGCGGCTGGATAGCCCAGGCCACGGCGACGGCCCTCCAGGAACGCGGCATCGCTCCC
GCCGCCGTCGTCCTCCTGGACAGCCACCGCCCGGACAGCGCGATGCTCCCGCACCTGCAC
GCCCACATCGACGGCGCGCGCGAGGACGTCCTCTGGACGGCCGGAACCGGGGACGACGCC
TACCTGACCGCCATGGCGCACTACGCCCACCTCTTCCACACCTGGACCCCGAAGGAGACC
GGCACGCCGACCCTCCTGGTCCGAGCCTCCGACCGCCCCTTCGACGAGGCGCCGACCGAC
TGGCAGCCGCACTGGCCCCTCCCGCACACCGCCGTCGACACGGCCGGCACGCACTTCTCG
ATCATCCGAGAACACAGTGGCCCCACGCTCCAGGCGGTCCACGCCTGGCTCGACGGTCTC
CACTGA
[3] KS34..408
[3] AT572..892
[3] methylmalonyl-CoA764..768
[3] ACP964..1034
[4] KS1056..1434
[4] at1598..1694
[4] ACP1843..1913
[4] TE1987..2197
[3] KS100..1224
[3] AT1714..2676
[3] methylmalonyl-CoA2290..2304
[3] ACP2890..3102
[4] KS3166..4302
[4] at4792..5082
[4] ACP5527..5739
[4] TE5959..6591

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [1987-2197]  6.70000000000001e-29 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [561-695]  1.99999999999999e-96 G3DSA:3.40.366.10 [764-881]  1.99999999999999e-96 G3DSA:3.40.366.10 [1598-1775]  7.5e-94 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1871-1886]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [964-1034]  PS50075 [1843-1913]  PS50075
PS50075   ACP_DOMAIN
 [967-1033]  4.5e-09 PF00550 [1846-1912]  6.70000000000001e-15 PF00550
PF00550   PP-binding
 [957-1073]  1.89999859865865e-23 SSF47336 [1836-1933]  2.39999798157265e-21 SSF47336
SSF47336   ACP_like
 [964-1039]  4.9e-40 G3DSA:1.10.1200.10 [1844-1915]  4.9e-40 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-283]  1.39999999999997e-93 PF00109 [1056-1308]  1.10000000000001e-90 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [291-408]  6.09999999999996e-48 PF02801 [1316-1434]  1.9e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [572-892]  2.59999999999995e-104 PF00698 [1598-1694]  6.60000000000002e-12 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [3-34]  6.69999687625999e-06 SSF101173
SSF101173   Polyketide_synth_docking
 [1-27]  5.8e-11 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [570-873]  1.40000506907309e-64 SSF52151 [1588-1787]  9.70001793430487e-19 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [698-763]  9.70001793430487e-19 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-295]  G3DSA:3.40.47.10 [296-462]  1e-127 G3DSA:3.40.47.10 [1056-1319]  G3DSA:3.40.47.10 [1320-1487]  1e-127 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-407]  9.40003071030835e-98 SSF53901 [1049-1486]  3.89999861795218e-97 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [196-212]  PS00606 [1221-1237]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [574-872]  3.10001307370203e-116 SM00827
SM00827   PKS_AT
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [1989-2197]  2.89997807423186e-111 SM00824
SM00824   PKS_TE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [965-1037]  1.10000150671642e-24 SM00823 [1844-1916]  2.10000267834031e-29 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-461]  SM00825 [1059-1486]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit