close all open/close all
Aureo_00080 Aureo_00080   last last

CDS information : Aureo_00090


close this sectionLocation

Organism
StrainHKI-227
Entry nameAureothin
Contig
Start / Stop / Direction28,440 / 29,132 / + [in whole cluster]
28,440 / 29,132 / + [in contig]
Location28440..29132 [in whole cluster]
28440..29132 [in contig]
TypeCDS
Length693 bp (230 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductO-methyltransferase
Product (GenBank)O-methyl transferase
Gene
Gene (GenBank)aurI
EC number2.1.1.-
Keyword
  • gamma-pyrone ring moiety
Note
Note (GenBank)
Reference
ACC
PmId
[14700630] Iteration as programmed event during polyketide assembly; molecular analysis of the aureothin biosynthesis gene cluster. (Chem Biol. , 2003)
[16292785] Dissection of the late steps in aureothin biosynthesis. (Chembiochem. , 2006)
[18690656] Chemoenzymatic total synthesis of the antiproliferative polyketide (+)-(R)-aureothin. (Chembiochem. , 2008)
Related Reference
ACC
Q2P9Z9
NITE
Stref_00160
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>O-methyltransferase [O-methyl transferase]
MTTTSASTTDHLIDQQVIDGQAGYTKSFLNIYDLAVFKGTAPLAWHCSPAVSRQMYDTCL
GANHVEIGVGTGYLLDNATFPVADPKITLVDLNPNSLAHTAQRLNRYDVTTVRANVLEPL
PLEERAYDSVGMSYLLHCVPGSIKEKGIALKHAAAVVRPGGVVFGATVLSSGVPVSARGR
WTMNYLNKRGDFHNQEDNYDDLRDQLAQYFPRFQLTSRGCVGIWRAWTTD
selected fasta
>O-methyltransferase [O-methyl transferase]
ATGACCACCACCAGCGCAAGCACGACCGACCACCTCATCGACCAGCAGGTCATCGACGGG
CAGGCCGGCTACACGAAGTCGTTCCTCAACATCTACGACCTCGCGGTCTTCAAGGGCACC
GCCCCCCTCGCCTGGCACTGCTCGCCCGCCGTCTCCCGGCAGATGTACGACACCTGCCTC
GGGGCCAACCACGTGGAGATCGGCGTCGGCACCGGCTACCTCCTCGACAACGCCACCTTC
CCGGTCGCCGACCCGAAGATCACCCTCGTCGACCTCAACCCCAACTCCCTGGCCCACACG
GCCCAGCGCCTCAACCGCTACGACGTCACCACGGTCCGCGCCAACGTCCTCGAACCCCTC
CCGCTCGAGGAACGCGCCTACGACTCGGTCGGCATGAGCTACCTCCTCCACTGCGTCCCC
GGCAGCATCAAGGAGAAGGGCATCGCCCTGAAGCACGCCGCGGCCGTCGTCCGCCCCGGC
GGCGTTGTCTTCGGCGCCACCGTCCTCTCCTCCGGCGTCCCGGTCAGCGCCCGCGGCCGC
TGGACGATGAACTACCTCAACAAGCGCGGCGACTTCCACAACCAGGAAGACAACTACGAC
GACCTCCGCGACCAACTCGCCCAGTACTTCCCCCGCTTCCAGCTGACGTCACGCGGCTGC
GTGGGCATCTGGCGCGCCTGGACGACTGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013217 Methyltransferase type 12 (Domain)
 [65-162]  2.9e-11 PF08242
PF08242   Methyltransf_12
IPR016584 S-adenosyl-L-methionine dependent methyltransferase, YbcY, predicted (Family)
 [1-230]  PIRSF011491
PIRSF011491   Mtase_YbcY_prd
SignalP No significant hit
TMHMM No significant hit
Aureo_00080 Aureo_00080   last last