close all open/close all
first first   Aver_00020 Aver_00020

CDS information : Aver_00010


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction327 / 3,176 / + [in whole cluster]
327 / 3,176 / + [in contig]
Location327..3176 [in whole cluster]
327..3176 [in contig]
TypeCDS
Length2,850 bp (949 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional regulator
Product (GenBank)
Gene
Gene (GenBank)aveR
EC number
Keyword
Note
Note (GenBank)
  • contains helix-turn-helix DNA binding domain; positive response regulator
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[19148632] Characterization of a regulatory gene, aveR, for the biosynthesis of avermectin in Streptomyces avermitilis. (Appl Microbiol Biotechnol. , 2009)
[20012992] The pathway-specific regulator AveR from Streptomyces avermitilis positively regulates avermectin production while it negatively affects oligomycin biosynthesis. (Mol Genet Genomics. , 2010)
[26298701] The PhoP transcription factor negatively regulates avermectin biosynthesis in Streptomyces avermitilis. (Appl Microbiol Biotechnol. , 2015)

close this sectionSequence

selected fasta
>LuxR family transcriptional regulator
MQGVSCLHPPRKPEELTLVDRETQFRALRLALTECAAGTVKLLVAEGGMGCGKSTFLGEA
LHTAAASGFAVLRAAGLPADHRQPLGVLQQLLNDPAPEDTARTAVRPMPVQHVRGALERL
AAGAPLAIGIDDVQDADPESLHCLMRLTRHSPTSRILLLCTALACSPAADPVLEAELMRQ
TAFERITLDCLSLDGVTGLVSDRCARPTAPPPADYCLTVTGGNPLLLRALLEEHSEADAP
SAPRPAEPSALHSPPQAAPPRPVVGGRFYQSVLACLSRTETAIRQTAGALAVLGGRARAD
LLPQLLGASPASVTRGLRALEATGLTTSGRFRHPVAEAAALDALDPSRRAHLHRRAAALQ
HHDGAAPRDVARHLLAARHAAGPWAVSVLRDAAEQSLAQDDVASAVSCLELAYGACVRER
ERPEIRIRLAAAFGRTNIAVAEEHLADLVATLREGELTGHQTALLVPLLVNHGRLGEARE
AMDRLNAADDARGLCADGGFPMAAPWPSTAHLAARRDPAARRDPGTRRDPADKPFLPRQS
GAPQPRPEDGRGQQPTAALWALPGNGTSEAAAHAAEQVLRSSPLTDSTLVLLVNAVRILA
RTGRYDTADIWCHRLLGEATRRRCPGWQAHLLAVRAELSLCRGLLADAKECAQRALTHVP
GHSRSVFAGGPLACQVLACTAMGRYDEATQLLSHPVPEALFHSVYGLGYLRARGHFHLAM
NRLPAAVRDFLTAGRVAREWGLDHPVLLPWRTDAAEAFLRLGETKRADQLLTEQLVSPHS
GNPYVRGTALRLRAQTAAPAERLRLLSEAVSDLQSSGDRLALARALADLGAAYHSRNEPV
RASATVRRAWQLAKECGAQALCDSILPSRGTKDRGPDGRAAATEALLSESEMRVATLAAG
GNTNREIAGRLCVTVSTVEQHLTRVYRKLNITRRRELPTRLRHLADQAN
selected fasta
>LuxR family transcriptional regulator
ATGCAGGGAGTTTCCTGTCTGCACCCCCCTCGGAAACCAGAAGAACTCACGCTCGTCGAC
CGGGAAACACAGTTCCGCGCGCTGCGGCTGGCCCTTACCGAATGCGCGGCCGGCACGGTG
AAACTGCTCGTCGCCGAGGGCGGAATGGGCTGTGGAAAGAGTACGTTCCTGGGCGAGGCA
CTGCACACCGCCGCCGCCTCCGGCTTCGCCGTCCTGCGTGCCGCCGGGCTTCCCGCGGAC
CACCGGCAACCCCTCGGCGTACTGCAGCAACTGCTGAACGACCCCGCCCCCGAGGACACC
GCCCGCACCGCCGTCCGCCCCATGCCGGTGCAACACGTCCGCGGCGCCCTCGAACGCCTC
GCCGCCGGCGCCCCGCTGGCGATCGGCATCGACGACGTACAGGACGCGGACCCGGAGTCG
CTGCACTGTCTGATGCGCCTCACCCGCCACTCCCCCACCTCGCGGATCCTGCTGCTGTGC
ACCGCCCTGGCGTGCAGTCCGGCCGCCGACCCGGTACTCGAAGCCGAGCTGATGCGTCAG
ACCGCCTTCGAACGCATCACGCTGGACTGCCTGTCCCTGGACGGAGTGACCGGGCTGGTC
TCGGACCGCTGCGCGCGGCCCACGGCGCCCCCGCCGGCGGACTACTGCCTGACCGTCACC
GGGGGCAACCCGCTGCTGCTGCGGGCCCTGCTCGAAGAGCACAGCGAGGCCGACGCCCCC
TCGGCACCCCGCCCGGCGGAGCCCTCCGCGCTGCACTCCCCGCCGCAGGCCGCCCCGCCG
CGCCCGGTCGTCGGCGGCCGCTTCTACCAGTCCGTACTGGCCTGCCTGTCCCGCACGGAG
ACGGCGATCAGGCAGACGGCCGGCGCCCTCGCCGTCCTCGGCGGGCGTGCGCGCGCCGAC
CTGCTCCCCCAACTGCTCGGCGCGAGTCCCGCGTCGGTCACCCGGGGGCTGCGTGCGCTG
GAGGCGACGGGGCTGACCACCTCCGGCCGTTTCCGGCACCCGGTGGCCGAGGCCGCCGCG
CTCGACGCACTGGACCCGAGCCGCCGTGCCCACCTGCACCGCCGAGCGGCGGCGCTGCAG
CACCACGACGGCGCGGCGCCGCGGGACGTCGCCCGCCACCTTCTCGCGGCCCGCCATGCG
GCGGGCCCCTGGGCGGTGTCCGTGCTGCGTGACGCCGCCGAGCAGTCGCTGGCGCAGGAC
GACGTGGCGTCGGCGGTCTCCTGCCTGGAACTCGCCTACGGGGCCTGTGTCCGGGAACGG
GAACGTCCGGAGATCAGGATCAGGCTCGCCGCCGCTTTCGGGCGCACCAACATCGCGGTG
GCGGAAGAGCACCTCGCCGACCTGGTCGCCACCTTGCGGGAAGGAGAATTGACCGGCCAT
CAGACGGCTTTACTCGTCCCTCTGCTCGTCAACCACGGCCGCCTCGGCGAAGCGCGGGAG
GCGATGGACCGGCTCAACGCCGCCGACGACGCGCGCGGCCTGTGCGCGGACGGCGGCTTC
CCGATGGCCGCTCCGTGGCCGTCGACCGCACACCTCGCCGCACGCCGCGATCCCGCCGCG
CGCCGCGATCCCGGCACCCGCCGCGATCCCGCCGACAAGCCGTTCCTGCCCCGGCAGTCC
GGTGCCCCGCAGCCCCGGCCGGAGGACGGCCGTGGCCAGCAGCCGACAGCGGCCTTGTGG
GCCCTGCCCGGAAACGGCACCAGCGAGGCGGCCGCACACGCCGCGGAACAGGTACTGCGG
TCCTCCCCGCTCACCGACAGCACCCTCGTGCTCCTGGTGAACGCCGTGCGGATCCTCGCC
CGCACGGGCCGGTACGACACCGCGGACATCTGGTGCCACCGCCTGCTCGGCGAGGCCACC
CGTCGCCGTTGTCCCGGCTGGCAGGCGCACCTCCTGGCGGTGCGGGCCGAACTCTCGCTG
TGCCGTGGCCTGCTCGCCGACGCCAAGGAGTGCGCCCAGCGCGCACTGACACACGTACCG
GGGCACAGCCGCAGCGTCTTCGCGGGCGGTCCGCTGGCCTGCCAGGTCCTCGCCTGCACC
GCGATGGGACGCTACGACGAAGCCACGCAACTGCTCAGCCATCCGGTTCCCGAGGCGCTG
TTCCACAGTGTGTACGGCCTGGGGTACCTGCGGGCCCGGGGCCATTTCCACCTGGCCATG
AACCGCCTGCCCGCCGCCGTCCGCGACTTCCTCACCGCCGGCCGGGTGGCGCGGGAGTGG
GGACTGGACCATCCGGTGCTGCTGCCCTGGCGTACGGACGCCGCGGAGGCGTTCCTCCGG
CTCGGGGAAACGAAGAGGGCCGACCAACTCCTCACCGAACAGCTCGTCTCCCCGCACAGC
GGCAACCCGTACGTCCGCGGCACCGCGCTGCGCCTGCGGGCCCAGACCGCGGCGCCGGCG
GAACGGCTCCGGCTGCTGAGCGAGGCGGTCAGTGACCTCCAGAGCTCCGGCGACCGCCTG
GCGCTGGCCCGCGCACTGGCCGATCTCGGCGCCGCGTATCACAGCCGGAACGAGCCCGTA
CGGGCGAGCGCCACGGTCCGCCGCGCCTGGCAGCTGGCCAAGGAGTGCGGAGCCCAGGCC
CTGTGCGACAGCATCCTGCCCAGTCGCGGCACCAAGGACCGGGGGCCCGACGGAAGGGCG
GCCGCGACCGAGGCCCTGCTGAGCGAGTCCGAGATGCGAGTCGCGACACTGGCGGCGGGC
GGCAACACCAACCGTGAGATCGCCGGCCGGCTCTGCGTCACCGTCAGCACGGTCGAACAG
CATCTGACGCGGGTCTACCGCAAACTGAACATCACCCGCCGCAGGGAGCTGCCGACCCGT
CTGCGACACCTCGCGGACCAGGCCAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [884-941]  2.49999811956465e-19 SM00421
SM00421   HTH_LUXR
 [887-901]  8.00000024242803e-08 PR00038 [901-917]  8.00000024242803e-08 PR00038 [917-929]  8.00000024242803e-08 PR00038
PR00038   HTHLUXR
 [901-928]  PS00622
PS00622   HTH_LUXR_1
 [880-945]  PS50043
PS50043   HTH_LUXR_2
 [886-937]  4.6e-11 PF00196
PF00196   GerE
IPR011990 Tetratricopeptide-like helical (Domain)
 [564-896]  4.40000000000001e-19 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [897-940]  2.1e-15 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [865-944]  3.7999986264479e-15 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit
first first   Aver_00020 Aver_00020