close all open/close all

CDS information : Aver_00020


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction4,026 / 3,223 / - [in whole cluster]
4,026 / 3,223 / - [in contig]
Locationcomplement(3223..4026) [in whole cluster]
complement(3223..4026) [in contig]
TypeCDS
Length804 bp (267 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-5 ketoreductase
Product (GenBank)C-5 ketoreductase
Gene
Gene (GenBank)aveF
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • post-polyketide modification
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
Related Reference
ACC
Q9ZGC1
NITE
Lando_00190
PmId
[16283688] LanV, a bifunctional enzyme: aromatase and ketoreductase during landomycin A biosynthesis. (Chembiochem. , 2005)
[22633416] Tailoring enzymes involved in the biosynthesis of angucyclines contain latent context-dependent catalytic activities. (Chem Biol. , 2012)
[22454092] Elucidation of post-PKS tailoring steps involved in landomycin biosynthesis. (Org Biomol Chem. , 2012)

close this sectionSequence

selected fasta
>putative C-5 ketoreductase [C-5 ketoreductase]
MADLKGRAALVTGASRGIGRAIAQRLAAEGLLVAVHYGSQEKAAAETVEAIERVGGEAFP
VRADLRRDDAVDTLFAEVENRLDGRPLHVLVNNAGVQSPPAPEGAGGKGEDVTSVSGVTA
AEFDHLFRINVRAPFFIIQRALRLIGEGGRVINVSSALTRIAWPLLPYAMSKGALEMIAP
RLALELGARGITVNTVAPGITATDMNRAMRDVPGVEERISALTALRRLGRPGDIAGVVAF
LASDEGRWVTGQLVDASGGLCIAPAMS
selected fasta
>putative C-5 ketoreductase [C-5 ketoreductase]
GTGGCGGATCTCAAGGGAAGGGCGGCTCTCGTCACCGGAGCCTCACGCGGAATCGGCAGG
GCGATTGCCCAACGGCTCGCCGCGGAAGGTCTTCTGGTGGCCGTTCACTACGGCAGCCAG
GAAAAGGCGGCCGCGGAAACGGTCGAGGCCATCGAACGGGTCGGCGGGGAGGCCTTCCCG
GTCCGGGCCGACCTCCGCCGCGACGACGCCGTCGACACCCTGTTCGCAGAAGTCGAGAAC
CGTCTGGACGGGCGCCCGCTCCATGTCCTGGTGAACAACGCCGGGGTGCAGTCGCCCCCC
GCACCGGAGGGAGCCGGGGGAAAGGGTGAGGACGTCACCAGCGTCTCCGGCGTCACCGCC
GCGGAGTTCGATCACCTGTTCAGGATCAATGTGCGGGCCCCGTTCTTCATCATCCAGCGG
GCCCTGCGGCTCATCGGTGAGGGCGGACGCGTCATCAACGTCTCGTCCGCCCTCACCCGG
ATCGCCTGGCCGCTCCTGCCGTACGCCATGAGCAAGGGTGCCCTGGAAATGATCGCGCCG
CGCCTGGCCCTTGAGCTCGGCGCGCGCGGCATCACGGTCAACACCGTCGCTCCCGGGATC
ACCGCCACCGACATGAACCGCGCGATGCGCGATGTGCCCGGGGTCGAGGAACGCATTTCC
GCCCTCACCGCGCTGCGCCGCCTGGGGCGTCCAGGGGACATCGCCGGTGTGGTGGCCTTC
CTCGCCTCCGACGAAGGCCGTTGGGTCACCGGTCAGTTGGTGGATGCGAGTGGGGGGCTG
TGCATCGCGCCCGCCATGTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [8-186]  1.2e-24 PF00106
PF00106   adh_short
 [85-96]  6.3e-08 PR00080 [149-157]  6.3e-08 PR00080 [168-187]  6.3e-08 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  9e-38 PR00081 [85-96]  9e-38 PR00081 [143-159]  9e-38 PR00081 [168-187]  9e-38 PR00081 [189-206]  9e-38 PR00081 [224-244]  9e-38 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-262]  2.3e-75 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP
 [1-28]  0.12 Signal
Eukaryota   
 [1-27]  0.114 Signal
Bacteria, Gram-negative   
TMHMM No significant hit