close all open/close all

CDS information : Aver_00030


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction5,762 / 4,911 / - [in whole cluster]
5,762 / 4,911 / - [in contig]
Locationcomplement(4911..5762) [in whole cluster]
complement(4911..5762) [in contig]
TypeCDS
Length852 bp (283 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-5 O-methyltransferase
Product (GenBank)C5-O-methyltransferase
Gene
Gene (GenBank)aveD
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • post-polyketide modification
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[9469930] Cloning of the gene encoding avermectin B 5-O-methyltransferase in avermectin-producing Streptomyces avermitilis. (Gene. , 1998)

close this sectionSequence

selected fasta
>C-5 O-methyltransferase [C5-O-methyltransferase]
MMAVPEQTPPSSLEVGDYYDRLTDLMNRALGGNTHLGYWPQPGDGSSPGKAADRLTDLLI
GKLRGITGRRVLDVGCGSGKPAVRLALSAPVDVVGVTVSEVQVGLATALAKQSHVADRVV
FTRADAMELPFPDGSFDAAWALECLLHMPSPAQVIREIARVLRPGGRLAVTDVALRAFGR
TGMKRGECTSQLLAVPALVHIDEYAGMIADAGLELHELTDIGDQVVGPSFAALRDHVNEH
LDEYAAAFGIGVAEMRKVVAQCTTLPWTPDIGYVVLTARRPGE
selected fasta
>C-5 O-methyltransferase [C5-O-methyltransferase]
ATGATGGCCGTCCCGGAGCAGACCCCGCCCTCTTCCCTGGAAGTGGGGGACTACTACGAC
CGTTTGACCGACCTCATGAATCGTGCGCTGGGTGGGAACACCCACCTCGGATACTGGCCG
CAGCCGGGGGACGGCAGTTCACCGGGCAAGGCCGCCGACCGGCTCACCGATCTCCTCATC
GGCAAGCTGAGAGGCATCACGGGCCGCCGGGTCCTGGACGTCGGCTGCGGTTCCGGAAAG
CCGGCGGTGCGGCTCGCCCTGAGCGCGCCCGTCGATGTCGTCGGCGTGACGGTGAGCGAG
GTTCAGGTCGGGCTGGCGACCGCTCTCGCGAAGCAGTCGCACGTGGCGGACCGGGTCGTG
TTCACCCGTGCCGACGCGATGGAACTGCCGTTTCCCGACGGGTCCTTCGACGCGGCGTGG
GCCCTGGAGTGTCTCCTGCACATGCCCAGCCCCGCACAGGTGATCCGGGAGATCGCCCGG
GTGCTCCGCCCCGGCGGCCGGCTGGCCGTCACGGACGTCGCACTGCGCGCCTTCGGGCGG
ACCGGCATGAAGCGCGGGGAGTGCACGTCCCAGTTGCTCGCGGTCCCGGCCCTGGTGCAC
ATCGACGAGTACGCCGGAATGATCGCCGACGCCGGGCTGGAACTGCATGAGCTGACCGAC
ATCGGCGATCAGGTCGTCGGCCCCTCTTTCGCCGCGCTGCGTGACCACGTGAACGAGCAC
CTCGACGAGTACGCGGCGGCCTTCGGGATCGGCGTCGCGGAGATGCGGAAGGTGGTTGCA
CAGTGCACGACGCTCCCCTGGACGCCGGACATCGGCTATGTCGTGCTGACCGCCCGGCGC
CCGGGGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [72-169]  2.5e-23 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit