close all open/close all

CDS information : Aver_00040


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction6,099 / 18,017 / + [in whole cluster]
101 / 12,019 / + [in contig]
Location6099..18017 [in whole cluster]
101..12019 [in contig]
TypeCDS
Length11,919 bp (3,972 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase AVES 1
Gene
Gene (GenBank)aveA1
EC number
Keyword
Note
Note (GenBank)
  • contains a loading module, Ave module 1 and module 2; multifunctional polyketide synthase
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[11780788] Organization of biosynthetic gene cluster for avermectin in Streptomyces avermitilis: analysis of enzymatic domains in four polyketide synthases. (J Ind Microbiol Biotechnol. , 2001)
[25581064] Structural and functional analysis of the loading acyltransferase from avermectin modular polyketide synthase. (ACS Chem Biol. , 2015)

close this sectionPKS/NRPS Module

0 2-methylbutyryl-CoA for a component
isobutyryl-CoA for b component
1 methylmalonyl-CoA
not conserved YASHS(S->C)
2 malonyl-CoA
AT29..353
ACP382..452
KS481..860
AT1050..1368
KR1715..1895
ACP1991..2061
KS2086..2462
AT2638..2951
DH3005..3176
KR3537..3717
ACP3817..3887

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase AVES 1]
MQRMDGGEEPRPAAGEVLGVADEADGGVVFVFPGQGPQWPGMGRELLDASDVFRESVRAC
EAAFAPYVDWSVEQVLRDSPDAPGLDRVDVVQPTLFAVMISLAALWRSQGVEPCAVLGHS
LGEIAAAHVSGGLSLADAARVVTLWSQAQTTLAGTGALVSVAATPDELLPRIAPWTEDNP
ARLAVAAVNGPRSTVVSGAREAVADLVADLTAAQVRTRMIPVDVPAHSPLMYAIEERVVS
GLLPITPRPSRIPFHSSVTGGRLDTRELDAAYWYRNMSSTVRFEPAARLLLQQGPKTFVE
MSPHPVLTMGLQELAPDLGDTTGTADTVIMGTLRRGQGTLDHFLTSLAQLRGHGETSATT
VLSARLTALSPTQQQSLLLDLVRAHTMAVLNDDGNERTASDAGPSASFAHLGFDSVMGVE
LRNRLSKATGLRLPVTLIFDHTTPAAVAARLRTAALGHLDEDTAPVPDSPSGHGGTAAAD
DPIAIIGMACRFPGGVRSPKDLWELAASGGDAIGPFPTDRGWPTEQRHAQDPTQPGTFYP
QGGGFLHDAAHFDAGFFGISPREALAMDPQQRLLLETSWEAFERAGIDPLSVRGSRTGVF
AGALSFDYGPRMDTASSEGAADVEGHILTGTTGSVLSGRIAYSFGLEGPAITVDTGCSAS
LVTLHLACQSLRSGECTLALAGGVSVMSTLGMFIEFSRQRGLSVDGRCKAYSAAADGTGW
GEGVGMLLVERLSDAVRLGHRVLAVVRGSAVNQDGASNGLTAPNGPAQERVIRQALANAG
LSVADVDVVEGHGTGTTLGDPIEAQALLATYGQRAGDRPLWLGSLKSNIGHTMAAAGVGG
VIKMVMALREGVLPRTLHVDKPSPQVDWSAGAVRLLTEAVPWPGDAAGRLRRAGVSSFGI
GGTNAHVILEEAPAAGGCVAGGGVLEGAPGLAISVAESVAAPVAVSAPVAESVPVPVPVP
VPVPVSARSEAGLRAQAEALRQYVAVRPDVSLADVGAGLACGRAVLEHRAVVLAADREEL
VQGLGALAAGEPDRRVTTGHAPGGDRGGVVFVFPGQGGQWAGMGVRLLASSPVFARRMQA
CEEALAPWVDWSVVDILRRDAGDAVWERADVVQPVLFSVMVSLAALWRSYGIEPDAVLGH
SQGEIAAAHVCGALSLKDAAKTVALRSRALAAVRGRGGMASVPLPAQEVEQLIGERWAGR
LWVAAVNGPRSTAVSGDAEAVDEVLAYCAGTGVRARRIPVDYASHCPHVQPLREELLELL
GDISPQPSGVPFFSTVEGTWLDTTTLDAAYWYRNLHQPVRFSDAVQALADDGHRVFVEVS
PHPTLVPAIEDTTEDTAEDVTAIGSLRRGDNDTRRFLTALAHTHTTGIGTPTTWHHHYTH
HHTHPHPHTHLDLPTYPFQHQHYWLESSQPGAGSGSGAGAGSGAGSGRAGTAGGTAEVES
RFWDAVARQDLETVATTLAVPPSAGLDTVVPALSAWHRHQHDQARINTWTYQETWKPLTL
PTTHQPHQTWLIAIPETQTHHPHITNILTNLHHHGITPIPLTLNHTHTNPQHLHHTLHHT
RQQAQNHTTGAITGLLSLLALDETPHPHHPHTPTGTLLNLTLTQTHTQTHPPTPLWYATT
NATTTHPNDPLTHPTQAQTWGLARTTLLEHPTHTAGIIDLPTTPTPHTLQHLTQTLTQPH
HQTQLAIRTTGTHTRRLTPTTLTPTHQPPTPTPHGTTLITGGTGALATHLTHHLTTHQPT
QHLLLTSRTGPHTPHAQHLTTQLQQKGIHLTITTCDTSNPDQLQQLLNTIPPQHPLTTVI
HTAGILDDATLTNLTPTQLNNVLRAKAHSAHLLHQLTQHTPLTAFVLYSSAAATFGAPGQ
ANYAAANAYLDALAHHRHTHHLPATSIAWGTWQGNGLADSDKARAYLDRRGFRPMSPELA
TAAVTQAIADTERPYVVIADIDWSKIEHTSQTSDLVSAAREREPAVQRPTPPAELHKTLA
HQTSADQRAALLELVRDHVAAVLRHADPKAIAPDQSFRALGFDSLTAVEFRNLLIKATGL
RLPVSLVFDHPTPAKLAVHLQNQLRGTAAESAPSAAAVTAEASVTEPIAIVGMACRFPGG
VTSADDFWDLISSEQDAIGGFPTDRGWDLDTLYDPDPDHPGTCYTRNGGFLYDAGHFDAE
FFGISPREALAMDPQQRLLLETAWETIEHAGINPHTLHGTPTGVFTGTNGQDYALRVHNA
GQSTDGFALTGTAGSVISGRISYTFGFEGPAVSVDTACSSSLVALHLACQALRAGECSMA
LAGGVTVMSSPGAFVEFSRQRGLAADGHCKAFSAAADGTGWGEGVGMLLVERLSDAHRNG
HRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAGLSAGDVDAVEAHGTGTTLG
DPIEAQALLATYGQDRAGEGPLWLGSVKSNVGHTQAAAGVAGVIKMVMALRHGLLPRTLH
VDEPSPHVDWSAGAVQLLTETVPWPGGEGRLRRAGVSSFGVSGTNAHVILEEAPADDVPG
GPPAGEGDAGSDDEAAAGSPGVWPWLVSAKSQPALRAQAQALHAHLTDHPGLDLADVGYT
LAHARAVFDHRATLIAADRDTFLQALQALAAGEPHPAVIHSSAPGGTGTGEAAGKTAFIC
SGQGTQRPGMAHGLYHTHPVFAAALNDICTHLDPHLDHPLLPLLTQNDNDNEDAAALLQQ
TRYAQPALFAFQVALHRLLTDGYHITPHYYAGHSLGEITAAHLAGILTLTDATTLITQRA
TLMQTMPPGTMTTLHTTPHHITHHLTAHENDLAIAAINTPTSLVISGTPHTVQHITTLCQ
QQGIKTKTLPTNHAFHSPHTNPILNQLHQHTQTLTYHPPHTPLITANTPPDQLLTPHYWT
QQARNTVDYATTTQTLHQHGVTTYIELGPDNTLTTLTHHNLPNPPTTTLTLTHPHHHPQT
HLLTNLAKTTTTWHPHHYTHHDNQPHTHTHLDLPTYPFQHHHYWLESTQPGAGNVSAAGL
DPTEHPLLGATLELATDGGALLAGRLSLRSHPWLADHAVGGTVLLSGATFLELALHAGTY
VGCDRVDELTLHAPLVVPVDGGVSVQVGVAAADGEGRRLVSVYARGGSACGGGGASGGVW
TCHASGVLVEAAAGGVVVDGLAGVWPPRGAVAVDVDGVRDRLAGAGCVLGPVFSGLRAVW
RDGGDLLAEVCLPEEAWGDAAGFGLHPALLDGVVQPLSVLLPGGTGFGEGAGFGEGVRVP
AVWGGVSLHRAGVTGVRVRVSAVGRGGGREAVSVVVGDEAGVPVASVDRLELRPVDMGQL
RAVSVSAGRRGSLYAVQWAEVGPVPVCGQAWAWHEDVGESGGGPVPGVVVLRCPDAGAGG
GGGGGGGGGVGEVVGGVLGVVQGWLGLERFAGSRLVVVTRGAVVAGPEDGPVDVVGASVW
GLVRSAQAEHPDRFVLLDLDTDTGTDLDTGAGAGWGVDGGRVAAVVACGEPQLAVRGERL
LAARLKRLESSGDVPAQRSGDTRARRSDVPAQRSGGVPARRSVDVSGREVLPWLSGGSVL
VTGGTGVLGAAVARHLAGVCGVRDLLLVSRRGPDAPGAEGLRAELAALGAEVRIVACDVG
ERREVVRLLEGVPAGCPLTGVVHAAGVLDDATIASLTPERLGTVFAAKVDAALLLDELTR
GMELSAFVLFSSAAGILGSAGQGNYAAANAALDALAYRRRAAGLPGVSLAWGLWEEASGM
TGHLAGTDHRRIIRSGLHPMSTPDALALFDAALALDRPVLLPADLRPAPPLPPLLQDLLP
ATRRRTTRTTTTGGADNGAQLHARLAGQTHEQQHTTLLALVRSHIATVLGHTTPDTIPPD
RAFRDLGFDSLTAVELRNRLSRTTGLRLPTTLAFDHPNPTTLTHHLHTQLQPQPDNAVAP
VLAELDKLESALSALDKTDSASERVTLRLKSLMLRWNAPQHPTAESADDDEKFTSATEAE
IFKFIDNDLGLS
selected fasta
>polyketide synthase [type I polyketide synthase AVES 1]
GTGCAGAGGATGGACGGCGGGGAAGAACCCCGCCCTGCGGCAGGGGAGGTCCTCGGAGTG
GCCGACGAGGCGGACGGCGGCGTCGTCTTCGTTTTTCCCGGGCAGGGCCCGCAATGGCCG
GGCATGGGAAGGGAACTTCTCGACGCTTCCGACGTCTTCCGGGAGAGCGTCCGCGCCTGC
GAAGCCGCGTTCGCGCCCTACGTCGACTGGTCGGTGGAGCAGGTGTTGCGGGACTCGCCG
GACGCTCCCGGGCTGGACCGGGTGGACGTCGTCCAGCCGACCCTGTTCGCCGTCATGATC
TCCCTGGCCGCCCTCTGGCGCTCGCAAGGGGTCGAGCCGTGCGCGGTGCTGGGACACAGC
CTGGGCGAGATCGCGGCAGCCCACGTCTCGGGAGGCCTGTCCCTGGCCGACGCCGCACGC
GTGGTGACGCTTTGGAGCCAGGCACAGACCACCCTTGCCGGGACCGGCGCGCTCGTCTCC
GTCGCCGCCACGCCGGATGAGCTCCTGCCCCGAATCGCTCCGTGGACCGAGGACAACCCG
GCGCGGCTCGCCGTCGCAGCCGTCAACGGACCCCGGAGCACAGTCGTTTCCGGTGCCCGC
GAGGCCGTCGCGGACCTGGTGGCCGACCTCACCGCCGCGCAGGTGCGCACGCGCATGATC
CCGGTGGACGTTCCCGCCCACTCCCCCCTGATGTACGCCATCGAGGAACGGGTCGTCAGC
GGCCTGCTGCCCATCACCCCACGCCCCTCCCGCATCCCCTTCCACTCCTCGGTGACCGGC
GGCCGCCTCGACACCCGCGAGCTAGACGCGGCGTACTGGTACCGCAACATGTCGAGCACG
GTCCGGTTCGAGCCCGCCGCCCGGCTGCTTCTGCAGCAGGGGCCCAAGACGTTCGTCGAG
ATGAGCCCGCACCCGGTGCTGACCATGGGCCTCCAGGAGCTCGCCCCGGACCTGGGCGAC
ACCACCGGCACCGCCGACACCGTGATCATGGGCACGCTGCGCCGCGGCCAGGGCACCCTG
GACCACTTCCTGACGTCTCTCGCCCAACTACGGGGGCATGGTGAGACGTCGGCGACCACC
GTCCTCTCGGCACGCCTGACCGCGCTGTCCCCCACGCAGCAGCAGTCGCTGCTCCTGGAC
CTGGTGCGCGCCCACACCATGGCGGTGCTGAACGACGACGGAAACGAGCGCACCGCGTCG
GATGCCGGCCCATCGGCGAGTTTCGCCCACCTCGGCTTCGACTCCGTCATGGGTGTCGAA
CTGCGCAACCGCCTCAGCAAGGCCACGGGCCTGCGGTTGCCCGTGACGCTCATCTTCGAC
CACACCACGCCGGCCGCGGTCGCCGCGCGCCTTCGGACCGCGGCGCTCGGCCACCTCGAC
GAGGACACCGCGCCCGTACCGGACTCACCCAGCGGCCACGGAGGCACGGCAGCGGCGGAC
GACCCGATCGCCATCATCGGCATGGCATGCCGTTTCCCGGGCGGAGTCCGGTCCCCGAAG
GACCTGTGGGAGCTGGCCGCCTCGGGCGGAGACGCCATCGGGCCGTTCCCCACCGACCGC
GGATGGCCCACGGAACAGCGTCACGCCCAGGACCCCACGCAGCCCGGCACGTTCTATCCG
CAGGGAGGCGGGTTCCTTCACGACGCGGCGCACTTCGACGCCGGCTTCTTCGGAATCAGT
CCACGTGAGGCACTGGCGATGGATCCGCAGCAGCGGCTGCTGCTGGAGACGTCCTGGGAG
GCGTTCGAGCGGGCGGGAATCGATCCGCTGTCGGTACGCGGGTCCCGTACGGGCGTCTTC
GCGGGCGCCCTCTCCTTCGACTACGGCCCGCGTATGGACACCGCGTCGTCGGAGGGCGCC
GCGGACGTGGAGGGCCACATCCTCACCGGTACCACGGGCAGCGTCCTGTCGGGCCGTATC
GCCTACAGCTTCGGGCTGGAAGGGCCGGCGATCACCGTGGACACGGGGTGCTCGGCATCG
CTCGTGACGCTGCATCTGGCGTGCCAGTCGCTGCGGTCGGGTGAGTGCACGCTCGCGCTG
GCCGGCGGCGTCTCGGTCATGTCCACCCTCGGCATGTTCATCGAGTTCTCCCGGCAGCGC
GGGCTGTCGGTGGACGGCAGGTGCAAGGCGTACTCGGCTGCAGCCGACGGCACCGGCTGG
GGCGAGGGCGTCGGGATGCTGTTGGTGGAGCGGTTGTCGGATGCGGTGCGGCTGGGGCAT
CGGGTGCTGGCGGTGGTACGCGGCAGTGCGGTCAACCAGGACGGTGCGTCGAATGGGCTG
ACGGCGCCGAACGGTCCGGCTCAGGAGCGGGTGATCCGGCAGGCGTTGGCGAACGCGGGG
TTGTCCGTGGCGGATGTGGATGTGGTGGAGGGGCACGGGACGGGCACGACGCTGGGTGAT
CCGATCGAGGCACAGGCGTTGCTCGCCACGTACGGGCAGCGGGCCGGTGACAGGCCGCTG
TGGCTGGGGTCTCTGAAGTCCAACATCGGGCACACCATGGCTGCCGCGGGTGTGGGTGGG
GTCATCAAGATGGTGATGGCGTTGCGGGAGGGGGTGTTGCCGCGGACGTTGCATGTGGAT
AAGCCGTCGCCGCAGGTGGACTGGTCCGCGGGGGCGGTGCGGCTGCTGACGGAGGCGGTG
CCGTGGCCGGGGGACGCGGCAGGGCGGTTGCGGCGGGCGGGAGTGTCGTCGTTCGGGATC
GGCGGCACGAATGCGCATGTGATTTTGGAGGAGGCGCCGGCGGCGGGGGGCTGTGTTGCC
GGGGGTGGGGTGTTGGAGGGTGCTCCGGGTCTTGCCATTTCGGTGGCTGAGTCGGTGGCC
GCTCCAGTGGCTGTGTCTGCGCCGGTGGCTGAGTCGGTGCCGGTGCCGGTGCCGGTGCCG
GTTCCTGTGCCGGTGTCGGCTAGGTCTGAGGCTGGGTTGCGGGCGCAGGCGGAGGCGTTG
CGTCAGTACGTGGCAGTCCGGCCGGACGTTTCGCTTGCCGATGTGGGTGCGGGTCTGGCC
TGTGGGCGGGCTGTGCTGGAGCATCGTGCGGTCGTCCTGGCCGCGGACCGTGAGGAGCTG
GTGCAAGGGTTGGGGGCGCTGGCGGCGGGTGAGCCGGATCGGCGGGTGACCACGGGTCAT
GCGCCGGGTGGTGACCGGGGCGGTGTCGTCTTCGTGTTTCCCGGACAGGGTGGGCAGTGG
GCCGGGATGGGTGTGCGTCTGCTCGCCTCCTCTCCGGTGTTCGCCCGGCGGATGCAGGCG
TGCGAGGAGGCTCTGGCGCCGTGGGTGGACTGGTCTGTGGTGGACATCCTGCGCCGGGAC
GCGGGGGATGCGGTGTGGGAGCGGGCCGATGTGGTCCAGCCTGTGCTGTTCAGCGTCATG
GTGTCTTTGGCTGCTCTGTGGCGTTCCTACGGTATCGAACCCGACGCGGTCCTTGGCCAT
TCCCAGGGCGAGATCGCGGCCGCGCATGTGTGTGGGGCGCTGAGCCTGAAGGACGCGGCG
AAGACTGTTGCGCTGCGCAGCCGGGCGCTGGCCGCTGTGCGGGGCCGGGGCGGCATGGCC
TCAGTGCCGCTGCCTGCCCAGGAGGTGGAGCAGCTCATTGGTGAGCGGTGGGCGGGGCGG
TTGTGGGTGGCGGCGGTCAACGGCCCCCGCTCCACCGCCGTCTCGGGGGATGCCGAGGCG
GTGGACGAGGTGCTGGCGTACTGTGCCGGCACCGGGGTGCGGGCCCGGCGGATCCCGGTC
GACTATGCCTCGCACTGCCCCCATGTGCAGCCCCTGCGGGAGGAGTTGCTGGAGCTGCTG
GGGGACATCAGCCCGCAGCCGTCCGGCGTGCCGTTCTTCTCCACGGTGGAGGGCACCTGG
CTGGACACCACAACCCTGGACGCCGCCTACTGGTACCGCAACCTGCACCAGCCGGTCCGT
TTCAGCGATGCCGTCCAGGCCCTGGCGGATGACGGACACCGCGTCTTCGTCGAAGTCAGC
CCCCACCCCACCCTCGTCCCCGCCATCGAAGACACCACCGAAGACACCGCCGAAGACGTC
ACCGCGATCGGCAGCCTCCGCCGCGGCGACAACGACACCCGCCGCTTCCTCACCGCCCTC
GCCCACACCCATACCACCGGCATCGGCACACCCACCACCTGGCACCACCACTACACCCAC
CACCACACCCACCCCCACCCCCACACGCACCTCGACCTGCCCACCTACCCCTTCCAACAC
CAGCACTACTGGCTCGAGAGCTCACAGCCGGGTGCCGGATCCGGTTCGGGTGCCGGTGCC
GGTTCGGGTGCCGGTTCCGGGCGGGCAGGGACTGCGGGCGGGACGGCAGAGGTGGAGTCG
CGGTTCTGGGACGCGGTGGCCCGCCAGGACCTGGAAACGGTCGCGACCACACTCGCCGTG
CCCCCCTCCGCCGGCCTGGACACGGTGGTGCCCGCACTCTCCGCCTGGCACCGCCACCAA
CACGACCAAGCCCGCATCAACACCTGGACCTACCAGGAAACCTGGAAACCCCTCACCCTC
CCCACCACCCACCAACCCCACCAAACCTGGCTCATCGCCATCCCCGAAACCCAGACCCAC
CACCCCCACATCACCAACATCCTCACCAACCTCCACCACCACGGCATCACCCCCATCCCC
CTCACCCTCAACCACACCCACACCAACCCCCAACACCTCCACCACACCCTCCACCACACC
CGACAACAAGCCCAAAACCACACCACCGGAGCCATCACCGGCCTGCTCTCCCTCCTCGCC
CTCGACGAAACACCCCACCCCCACCACCCCCACACACCCACCGGCACCCTCCTCAACCTC
ACCCTCACCCAAACCCACACCCAAACCCACCCACCAACCCCCCTCTGGTACGCCACCACC
AACGCCACCACCACCCACCCCAACGACCCCCTCACACACCCCACCCAAGCCCAAACCTGG
GGACTCGCCCGCACCACCCTCCTCGAACACCCCACCCACACCGCCGGAATCATCGACCTC
CCCACCACCCCCACCCCCCACACCCTCCAGCACCTCACCCAAACCCTCACCCAACCCCAC
CACCAAACCCAACTCGCCATCCGCACCACCGGCACCCACACCCGCCGCCTCACCCCCACC
ACCCTCACCCCCACACACCAACCACCCACCCCCACCCCCCACGGAACCACCCTCATCACC
GGCGGAACCGGCGCCCTCGCCACCCACCTCACCCACCACCTCACCACCCACCAACCCACC
CAACACCTCCTCCTCACCAGCCGAACCGGCCCCCACACCCCCCACGCACAACACCTCACC
ACCCAACTCCAACAAAAAGGCATCCACCTCACCATCACCACCTGCGACACCAGCAACCCA
GACCAACTCCAACAACTCCTCAACACCATCCCCCCACAACACCCCCTCACCACCGTCATC
CACACCGCAGGCATCCTCGACGACGCCACCCTCACCAACCTCACCCCCACCCAACTCAAC
AACGTCCTCCGCGCCAAAGCCCACAGCGCCCACCTCCTCCACCAACTCACCCAACACACC
CCCCTCACCGCCTTCGTCCTCTACTCCTCCGCCGCCGCCACCTTCGGCGCACCCGGCCAA
GCCAACTACGCCGCAGCCAACGCCTACCTCGACGCCCTCGCCCACCACCGCCACACCCAC
CACCTCCCCGCCACCAGCATCGCCTGGGGCACCTGGCAAGGAAACGGACTCGCTGATTCG
GACAAGGCCCGCGCATATCTCGACCGCCGCGGGTTTCGACCCATGTCACCCGAGTTGGCC
ACGGCAGCGGTCACGCAGGCGATCGCGGACACCGAACGGCCGTATGTCGTCATCGCCGAC
ATCGACTGGAGCAAGATCGAACACACCTCTCAGACCAGCGACCTGGTGAGCGCGGCCCGG
GAAAGGGAGCCAGCTGTCCAGCGCCCCACTCCACCGGCGGAGTTGCACAAAACGCTGGCC
CATCAGACGTCGGCCGACCAACGGGCCGCATTGCTCGAGCTCGTACGAGACCATGTGGCG
GCAGTGCTCCGGCACGCGGACCCGAAAGCCATCGCGCCCGACCAGTCGTTCCGTGCACTC
GGCTTCGATTCACTCACGGCCGTCGAGTTCCGAAACCTGCTGATCAAGGCAACAGGACTC
CGCCTTCCTGTCTCGCTGGTCTTCGACCACCCGACCCCTGCCAAACTCGCCGTACACCTG
CAGAACCAACTGCGGGGCACAGCAGCGGAGTCGGCTCCTTCAGCGGCAGCCGTTACCGCC
GAGGCTTCTGTCACCGAGCCGATCGCCATCGTTGGCATGGCCTGTCGTTTCCCCGGCGGA
GTGACCTCGGCGGACGACTTCTGGGATCTGATCTCCTCCGAGCAGGACGCGATCGGCGGA
TTCCCCACCGACCGCGGCTGGGACCTGGACACGCTCTACGACCCCGACCCCGACCACCCC
GGCACCTGCTACACCCGAAACGGCGGATTCCTCTACGACGCAGGCCACTTCGACGCCGAA
TTCTTCGGCATCAGCCCCCGCGAAGCCCTCGCCATGGACCCCCAGCAACGACTCCTCCTC
GAAACCGCCTGGGAAACCATCGAACACGCCGGCATCAACCCCCACACCCTCCACGGCACC
CCCACCGGAGTCTTCACCGGCACCAACGGACAGGACTACGCACTTCGCGTGCACAACGCG
GGCCAGTCAACCGATGGTTTCGCACTGACCGGAACCGCCGGCAGCGTCATCTCCGGTCGT
ATCTCGTACACGTTTGGTTTTGAGGGTCCTGCGGTGTCGGTGGACACGGCTTGTTCCTCG
TCGTTGGTGGCTTTGCATCTGGCCTGTCAGGCGTTGCGTGCGGGTGAGTGCTCGATGGCG
CTTGCCGGGGGTGTGACGGTGATGTCGTCTCCGGGTGCCTTCGTGGAGTTTTCGCGGCAG
CGGGGTCTGGCCGCGGACGGGCATTGCAAGGCGTTCTCGGCGGCGGCGGACGGGACCGGC
TGGGGTGAGGGTGTGGGGATGCTGCTGGTGGAGCGGCTCTCCGACGCCCATCGCAACGGT
CACCGTGTCCTGGCCGTGGTGCGTGGCAGTGCGGTCAACCAGGACGGTGCGAGCAACGGT
CTGACCGCGCCCAACGGGCCGTCCCAGCAGCGTGTCATCCGCCAGGCCCTCGCCAACGCC
GGCTTGTCGGCCGGTGATGTCGACGCGGTGGAGGCCCACGGCACCGGCACCACTTTGGGC
GACCCGATCGAGGCCCAGGCCCTCCTCGCGACCTACGGACAGGACCGTGCCGGCGAGGGG
CCGCTGTGGCTGGGCTCGGTCAAGTCCAATGTCGGTCACACACAGGCTGCCGCGGGCGTC
GCCGGGGTGATCAAGATGGTGATGGCGCTGCGGCATGGTCTGCTGCCGCGGACGTTGCAT
GTGGATGAGCCGTCGCCGCATGTGGACTGGTCCGCGGGTGCGGTGCAGCTGCTGACGGAG
ACGGTGCCCTGGCCCGGCGGGGAGGGGCGGCTACGGCGGGCAGGAGTGTCATCATTCGGC
GTCAGCGGCACCAACGCCCACGTCATCCTCGAAGAAGCACCCGCCGACGACGTTCCGGGG
GGACCACCCGCCGGCGAGGGTGACGCGGGCAGCGACGATGAGGCTGCTGCCGGCAGTCCT
GGGGTGTGGCCGTGGCTGGTGTCGGCCAAGTCGCAGCCGGCCCTGCGCGCCCAGGCCCAG
GCCCTGCACGCCCACCTCACCGACCACCCCGGCCTCGACCTCGCGGATGTCGGATACACC
CTCGCCCACGCCCGCGCCGTGTTCGACCACCGCGCCACCCTCATCGCCGCGGACCGCGAC
ACGTTCCTGCAAGCACTCCAGGCACTCGCCGCAGGCGAGCCCCACCCCGCCGTCATCCAC
AGCAGCGCCCCGGGCGGGACCGGGACCGGGGAGGCCGCAGGAAAGACCGCATTCATCTGC
TCCGGACAGGGCACCCAACGCCCCGGCATGGCCCACGGCCTCTACCACACCCACCCCGTC
TTCGCCGCCGCACTCAACGACATCTGCACCCACCTCGACCCCCACCTCGACCACCCCCTC
CTCCCCCTCCTCACCCAAAACGACAACGACAACGAGGACGCGGCCGCACTGCTCCAGCAG
ACCCGCTACGCCCAGCCCGCCCTCTTCGCCTTCCAGGTCGCCCTCCACCGCCTCCTCACC
GACGGCTACCACATCACCCCCCACTACTACGCCGGACACTCCCTCGGCGAAATCACCGCC
GCCCACCTCGCCGGCATCCTCACCCTCACCGACGCCACCACCCTCATCACCCAACGCGCC
ACCCTCATGCAAACCATGCCCCCCGGCACCATGACCACCCTCCACACCACCCCCCACCAC
ATCACCCACCACCTCACCGCCCACGAAAACGACCTCGCCATCGCCGCCATCAACACCCCC
ACCTCCCTCGTCATCAGCGGCACCCCCCACACCGTCCAACACATCACCACCCTCTGCCAA
CAACAAGGCATCAAAACCAAAACCCTCCCCACCAACCACGCCTTCCACTCCCCCCACACC
AACCCCATCCTCAACCAACTCCACCAGCACACCCAAACCCTCACCTACCACCCACCCCAC
ACCCCCCTCATCACCGCCAACACCCCACCCGACCAACTCCTCACCCCCCACTACTGGACC
CAACAAGCCCGCAACACCGTCGACTACGCCACCACCACCCAAACCCTCCACCAACACGGC
GTCACCACCTACATCGAACTCGGACCCGACAACACCCTCACCACCCTCACCCACCACAAC
CTCCCCAACCCCCCCACCACCACCCTCACCCTCACCCACCCCCACCACCACCCCCAAACC
CACCTCCTCACCAACCTCGCCAAAACCACCACCACCTGGCACCCCCACCACTACACCCAC
CACGACAACCAACCCCACACCCACACCCACCTCGACCTCCCCACCTACCCCTTCCAACAC
CACCACTACTGGCTCGAAAGCACACAGCCCGGTGCCGGCAACGTGTCAGCAGCCGGACTC
GACCCCACCGAACACCCCCTACTCGGCGCCACATTGGAACTGGCGACTGACGGTGGAGCG
CTTCTTGCAGGGCGCTTGTCTTTGAGGTCGCATCCGTGGCTGGCTGACCATGCCGTCGGC
GGCACGGTGCTGCTGTCGGGCGCCACCTTCCTCGAACTCGCCCTTCATGCGGGCACATAC
GTGGGCTGCGACCGAGTGGATGAGCTGACGCTGCATGCGCCGCTGGTGGTTCCTGTGGAT
GGGGGTGTGAGTGTGCAGGTTGGGGTTGCGGCTGCGGATGGGGAGGGGCGGCGTTTGGTG
AGTGTGTATGCGCGGGGTGGGAGTGCTTGTGGTGGGGGTGGTGCGTCGGGTGGGGTGTGG
ACGTGTCATGCCTCGGGGGTGCTGGTTGAGGCTGCTGCTGGTGGTGTGGTGGTGGATGGT
CTGGCGGGGGTGTGGCCGCCGCGGGGTGCGGTGGCGGTGGATGTCGATGGTGTCCGTGAC
CGTTTGGCTGGGGCTGGTTGTGTTTTGGGGCCGGTGTTTTCGGGGCTGCGTGCGGTGTGG
CGTGATGGGGGGGATTTGCTGGCTGAGGTGTGTCTGCCGGAGGAGGCGTGGGGTGATGCG
GCTGGTTTTGGGCTGCATCCGGCGTTGCTGGATGGTGTGGTCCAGCCGTTGTCGGTGTTG
CTTCCGGGTGGGACGGGGTTTGGGGAGGGGGCGGGGTTCGGGGAGGGTGTTCGGGTGCCG
GCTGTGTGGGGTGGTGTGTCGCTTCACCGGGCGGGTGTGACCGGTGTGCGGGTGCGTGTG
TCGGCTGTCGGGCGGGGCGGCGGGCGTGAGGCGGTGTCGGTCGTGGTCGGGGATGAGGCG
GGTGTGCCGGTGGCGTCGGTCGATCGTCTTGAGTTGCGGCCTGTGGATATGGGTCAGTTG
CGTGCTGTCTCGGTTTCGGCGGGGCGGCGGGGTTCGCTGTATGCGGTGCAGTGGGCTGAG
GTGGGTCCTGTGCCGGTGTGTGGGCAGGCGTGGGCGTGGCACGAGGACGTGGGTGAGAGC
GGTGGTGGGCCTGTGCCGGGGGTGGTGGTGTTGCGGTGCCCGGATGCCGGTGCCGGTGGC
GGTGGCGGTGGCGGTGGTGGCGGTGGTGTGGGTGAGGTTGTTGGTGGGGTGTTGGGTGTG
GTGCAGGGGTGGCTGGGGCTGGAGCGGTTTGCGGGTTCGCGGCTGGTGGTGGTGACCCGG
GGTGCGGTGGTGGCCGGCCCGGAGGACGGCCCGGTGGATGTGGTGGGTGCGTCGGTGTGG
GGGCTGGTGCGTTCGGCGCAGGCTGAGCATCCGGACCGGTTTGTCCTCCTCGACCTCGAC
ACCGACACCGGCACCGACCTCGACACCGGTGCTGGTGCTGGTTGGGGCGTGGATGGTGGG
CGTGTGGCGGCGGTGGTGGCGTGTGGTGAGCCGCAGTTGGCGGTGCGTGGGGAGCGGTTG
CTGGCCGCACGCCTGAAACGACTTGAGTCATCCGGTGATGTTCCAGCCCAGCGGTCCGGT
GACACACGAGCCCGGCGGTCCGACGTGCCTGCCCAGCGCTCCGGTGGCGTGCCTGCTCGG
CGGTCGGTTGATGTATCGGGTCGGGAGGTGTTGCCGTGGTTGTCGGGTGGGTCGGTGTTG
GTGACGGGTGGGACGGGTGTGCTGGGTGCGGCGGTGGCGCGGCATCTGGCTGGTGTGTGT
GGGGTGCGGGATCTGCTGTTGGTGAGCCGGCGTGGTCCGGATGCTCCGGGTGCGGAGGGT
CTGCGGGCGGAGCTGGCCGCGTTGGGGGCGGAGGTGCGGATTGTTGCGTGTGATGTGGGG
GAGCGGCGGGAGGTGGTCCGGCTGCTGGAGGGTGTTCCTGCCGGGTGTCCGCTGACGGGT
GTCGTGCATGCGGCTGGTGTGCTGGACGATGCGACGATCGCCTCTCTCACGCCCGAGCGG
CTGGGCACGGTGTTCGCGGCCAAGGTGGATGCCGCTCTTTTGCTGGATGAGCTGACGCGG
GGTATGGAGCTGTCGGCGTTCGTGCTGTTCTCCTCGGCCGCGGGGATCCTGGGGTCGGCC
GGGCAGGGCAACTACGCCGCGGCCAATGCCGCTCTGGACGCGCTGGCGTACCGGCGGCGG
GCGGCGGGTCTGCCGGGGGTGTCGCTGGCGTGGGGGCTGTGGGAAGAGGCCAGCGGGATG
ACCGGGCACCTGGCCGGCACCGACCACCGGCGCATCATCCGTTCCGGTCTGCATCCCATG
TCGACCCCGGACGCACTGGCCCTCTTCGATGCGGCCCTGGCTCTGGACCGGCCGGTCCTG
CTGCCCGCCGACCTGCGTCCCGCCCCGCCCCTGCCGCCCCTGCTGCAGGACCTCCTGCCC
GCCACCCGCCGCCGCACCACCCGCACCACCACTACCGGTGGTGCGGACAACGGCGCCCAG
CTGCACGCCCGGCTGGCCGGCCAGACACACGAACAACAGCACACCACCCTCCTCGCCCTG
GTCCGCTCCCACATCGCCACCGTCCTGGGCCACACCACCCCCGACACCATCCCCCCCGAC
CGCGCGTTCCGCGACCTCGGCTTCGACTCCCTCACCGCCGTCGAACTACGCAACCGGCTC
TCCCGCACCACCGGACTCCGCCTCCCCACCACCCTCGCCTTCGACCACCCCAACCCCACC
ACCCTCACCCACCACCTCCACACACAACTCCAGCCACAACCGGACAACGCTGTCGCCCCC
GTGTTGGCGGAGCTCGACAAACTCGAATCCGCCCTCTCCGCCCTCGACAAAACCGACAGC
GCCAGCGAAAGAGTCACCCTGCGGCTGAAGTCACTCATGTTGAGGTGGAACGCACCCCAG
CATCCGACAGCCGAAAGCGCTGATGACGACGAGAAGTTCACATCGGCAACAGAGGCTGAG
ATTTTCAAATTCATTGACAACGACCTCGGCCTGTCCTGA
[0] AT29..353
[0] 2-methylbutyryl-CoA for a component isobutyryl-CoA for b component224..228
[0] ACP382..452
[1] KS481..860
[1] AT1050..1368
[1] methylmalonyl-CoA not conserved YASHS(S->C)1242..1246
[1] KR1715..1895
[1] ACP1991..2061
[2] KS2086..2462
[2] AT2638..2951
[2] malonyl-CoA2833..2837
[2] DH3005..3176
[2] KR3537..3717
[2] ACP3817..3887
[0] AT85..1059
[0] 2-methylbutyryl-CoA for a component isobutyryl-CoA for b component670..684
[0] ACP1144..1356
[1] KS1441..2580
[1] AT3148..4104
[1] methylmalonyl-CoA not conserved YASHS(S->C)3724..3738
[1] KR5143..5685
[1] ACP5971..6183
[2] KS6256..7386
[2] AT7912..8853
[2] malonyl-CoA8497..8511
[2] DH9013..9528
[2] KR10609..11151
[2] ACP11449..11661

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [25-152]  G3DSA:3.40.366.10 [224-346]  G3DSA:3.40.366.10 [1046-1173]  G3DSA:3.40.366.10 [1242-1359]  G3DSA:3.40.366.10 [2632-2766]  G3DSA:3.40.366.10 [2833-2940]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1715-1880]  1.5e-51 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [410-425]  PS00012 [3845-3860]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [399-451]  1.5e-09 PF00550 [1994-2059]  2.80000000000001e-12 PF00550 [3821-3886]  2e-12 PF00550
PF00550   PP-binding
 [382-452]  PS50075 [1991-2061]  PS50075 [3817-3887]  PS50075
PS50075   ACP_DOMAIN
 [371-497]  5.49999338756182e-23 SSF47336 [1984-2102]  1.79999754022375e-28 SSF47336 [3809-3904]  7.40000780398343e-24 SSF47336
SSF47336   ACP_like
 [376-453]  5.59999999999999e-64 G3DSA:1.10.1200.10 [1989-2066]  5.59999999999999e-64 G3DSA:1.10.1200.10 [3815-3891]  5.59999999999999e-64 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [3537-3716]  1.09999999999999e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [481-735]  1.9e-92 PF00109 [2086-2336]  3.49999999999995e-102 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [743-860]  6.40000000000004e-47 PF02801 [2344-2462]  1.40000000000001e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [29-353]  4.80000000000003e-99 PF00698 [1050-1368]  2.90000000000003e-111 PF00698 [2638-2951]  1.6e-50 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [27-333]  2.90000354677981e-63 SSF52151 [1048-1353]  3.699978135861e-68 SSF52151 [2635-2939]  1.40000506907309e-58 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [154-223]  3.59999643435987e-15 SSF55048 [1175-1241]  7.10001443313147e-19 SSF55048 [2767-2832]  8.19999506482837e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [483-747]  G3DSA:3.40.47.10 [748-913]  2.19999999999997e-130 G3DSA:3.40.47.10 [2086-2347]  G3DSA:3.40.47.10 [2348-2514]  2.19999999999997e-130 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [473-914]  9.40003071030835e-98 SSF53901 [2078-2460]  5.6999970878395e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1716-1901]  3.99999999999998e-66 G3DSA:3.40.50.720 [3534-3747]  1.79999999999997e-65 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [648-664]  PS00606 [2249-2265]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [31-337]  1.3000049540733e-111 SM00827 [1052-1350]  1.19999063421924e-125 SM00827 [2639-2992]  2.39999798157263e-103 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [379-455]  1.89999859865865e-24 SM00823 [1992-2064]  3.49999466863949e-33 SM00823 [3818-3890]  6.99997659850661e-36 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [3005-3176]  4.60000044330866e-71 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [483-914]  SM00825 [2088-2515]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1715-1895]  3.80000697093588e-52 SM00822 [3537-3717]  1.99999636034521e-57 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit