close all open/close all

CDS information : Aver_00060


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction36,785 / 37,828 / + [in whole cluster]
30,787 / 31,830 / + [in contig]
Location36785..37828 [in whole cluster]
30787..31830 [in contig]
TypeCDS
Length1,044 bp (347 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)AveC
Gene
Gene (GenBank)aveC
EC number
Keyword
  • spiroketal moiety
  • C22-23 dehydration
Note
Note (GenBank)
  • involved in postpolyketide modification
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[15721808] Semi-synthetic DNA shuffling of aveC leads to improved industrial scale production of doramectin by Streptomyces avermitilis. (Metab Eng. , 2005)
[18824353] Engineering of avermectin biosynthetic genes to improve production of ivermectin in Streptomyces avermitilis. (Bioorg Med Chem Lett. , 2008)
[23294008] Spiroketal formation and modification in avermectin biosynthesis involves a dual activity of AveC. (J Am Chem Soc. , 2013)

close this sectionSequence

selected fasta
>cyclase/dehydratase [AveC]
MNPSEPLGLPNERVVDTRPSDATLSPEAGLNRSGALPRELLSLPVVVWAGVGLLFLALQA
YVFSRWAADGGYRLIETAGQGQGGSKDTGTTDVVYPVISVVCITAAAAWLFRRCRVERRL
LFDALLFLGLLFASWQSPLMNWFHSVLVSNASVWGAVGSWGPYVPGWQGAGPGAEAEMPL
ASASVCMSALIVTVLCSKALGWIKARRPAWRTWRLVLAVFFIGIVLGLSEPLPSASGISV
WARALPEVTLWSGEWYQFPVYQAVGSGLVCCMLGSLRFFRDERDESWVERGAWRLPQRAA
NWARFLAVVGGVNAVMFLYTCFHILLSLVGGQPPDQLPDSFQAPAAY
selected fasta
>cyclase/dehydratase [AveC]
GTGAACCCATCCGAGCCGCTCGGCCTGCCCAACGAACGTGTAGTAGACACCCGACCGTCC
GATGCCACGCTCTCACCCGAGGCCGGCCTGAACAGGTCAGGAGCGCTGCCCCGTGAACTG
CTGTCGTTGCCGGTGGTGGTGTGGGCCGGGGTCGGCCTGCTGTTTCTGGCCCTGCAGGCG
TACGTGTTCAGCCGCTGGGCGGCCGACGGTGGCTACCGGCTGATCGAGACGGCGGGCCAG
GGTCAGGGCGGCAGCAAGGATACGGGGACTACCGATGTGGTCTATCCCGTGATTTCCGTC
GTCTGCATCACCGCCGCGGCGGCGTGGCTCTTCCGGAGGTGCCGTGTCGAACGACGGCTG
CTGTTCGACGCCCTTCTCTTCCTCGGGCTGCTGTTCGCGAGCTGGCAGAGCCCGCTCATG
AACTGGTTCCATTCCGTTCTCGTCTCCAACGCGAGTGTGTGGGGCGCGGTGGGTTCCTGG
GGTCCGTATGTGCCCGGCTGGCAGGGGGCGGGCCCGGGTGCGGAGGCGGAAATGCCGCTG
GCGTCGGCCTCCGTCTGCATGTCGGCTCTGATCGTCACCGTGCTGTGCAGCAAGGCACTG
GGGTGGATCAAGGCCCGCCGGCCGGCATGGCGGACCTGGCGGCTGGTCCTGGCCGTGTTC
TTCATCGGCATCGTGCTCGGTCTGTCCGAGCCGCTGCCGTCCGCCTCCGGGATCAGCGTA
TGGGCCAGAGCGCTGCCCGAGGTGACCTTGTGGAGTGGCGAGTGGTACCAGTTCCCCGTG
TATCAGGCGGTCGGTTCCGGCCTGGTCTGCTGCATGCTGGGCTCGCTGCGCTTCTTCCGC
GACGAACGCGATGAGTCGTGGGTGGAACGGGGAGCCTGGCGGTTGCCGCAACGGGCAGCG
AACTGGGCGCGTTTCCTCGCCGTGGTCGGTGGGGTGAATGCCGTGATGTTCCTCTACACC
TGTTTCCATATCCTCCTGTCCCTCGTCGGTGGACAGCCGCCCGACCAACTGCCGGACTCC
TTCCAAGCGCCGGCCGCTTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [40-62]  Transmembrane (i-o) [93-111]  Transmembrane (o-i) [124-146]  Transmembrane (i-o) [181-203]  Transmembrane (o-i) [216-238]  Transmembrane (i-o) [258-280]  Transmembrane (o-i) [305-327]  Transmembrane (i-o)
Transmembrane 7