close all open/close all

CDS information : Aver_00070


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction39,282 / 37,912 / - [in whole cluster]
33,284 / 31,914 / - [in contig]
Locationcomplement(37912..39282) [in whole cluster]
complement(31914..33284) [in contig]
TypeCDS
Length1,371 bp (456 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)cytochrome P450 hydroxylase
Gene
Gene (GenBank)aveE
EC number
Keyword
  • furan ring
Note
Note (GenBank)
  • probabry catalyzes furan ring formation at C6 to C8
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[7868391] Production of 6,8a-seco-6,8a-deoxy derivatives of avermectins by a mutant strain of Streptomyces avermitilis. (J Antibiot (Tokyo). , 1995)

close this sectionSequence

selected fasta
>cytochrome P450 [cytochrome P450 hydroxylase]
MMSQSTSSIPEAPGAWPVVGHVPPLMRQPLEFLRSAADHGDLLKLRLGPKTAYLATHPDL
VRTMLVSSGSGDFTRSKGAQGASRFIGPILVAVSGETHRRQRRRMQPGFHRQRLESYVAT
MAAAAQETADSWSAGQVVDVEQAACDLSLAMITKTLFFSDLGAKAEAALRKTGHDILKVA
RLSALAPTLYEVLPTAGKRSVGRTSATIREAITAYRADGRDHGDLLSTMLRATDAEGASM
TDQEVHDEVMGIAVAGIGGPAAITAWIFHELGQNAEIESRLHAELDTVLGGRLPTHEDLP
RLPYTQNLVKEALRKYPGWVGSRRTVRPVRLGGHDLPADVEVMYSAYAIQRDPRWYPEPE
RLDPGRWETKGSSRGVPKGAWVPFALGTYKCIGDNFALLETAVTVAVVASHWRLHALPGD
EVRPKTKATHVFPNRLRMIAEPRSVVRLEEPAAMGA
selected fasta
>cytochrome P450 [cytochrome P450 hydroxylase]
GTGATGTCCCAGTCGACGAGCAGCATTCCCGAGGCGCCCGGCGCCTGGCCGGTCGTCGGC
CATGTGCCGCCGTTGATGCGGCAGCCCCTGGAGTTCCTTCGCTCCGCAGCAGATCACGGA
GACCTGCTCAAGCTCCGCCTCGGGCCGAAAACCGCCTACCTCGCCACGCACCCGGACCTG
GTGCGGACCATGCTGGTCTCCTCCGGATCGGGCGATTTCACCCGGAGCAAGGGCGCACAG
GGCGCGAGCCGCTTCATCGGCCCCATCCTCGTAGCCGTATCGGGGGAGACGCACCGGCGA
CAGCGGAGGCGGATGCAGCCAGGGTTCCACCGCCAGCGCCTCGAGAGCTATGTCGCCACC
ATGGCGGCCGCCGCGCAGGAGACCGCTGATTCCTGGAGCGCTGGGCAGGTGGTGGACGTT
GAGCAGGCCGCCTGCGACCTGTCGCTTGCCATGATCACGAAGACGCTGTTCTTCTCCGAC
CTGGGCGCGAAGGCCGAGGCGGCGCTGCGGAAAACCGGACACGACATTCTGAAGGTGGCC
CGGCTGAGTGCTCTCGCCCCCACCCTTTACGAGGTTCTTCCCACCGCGGGCAAGCGGTCC
GTGGGCCGTACGAGCGCAACGATCCGGGAGGCGATCACGGCGTATCGCGCCGATGGCCGC
GACCACGGTGACCTGCTCTCGACGATGCTGCGCGCGACGGACGCCGAAGGTGCCTCCATG
ACGGACCAGGAGGTCCATGACGAGGTCATGGGAATCGCGGTGGCCGGGATCGGCGGCCCA
GCTGCCATTACGGCGTGGATTTTCCACGAGCTCGGACAGAACGCCGAGATCGAGAGTCGG
CTGCACGCAGAGCTCGACACGGTCCTGGGCGGGCGGTTGCCCACGCACGAGGACCTCCCG
CGGCTGCCGTACACACAGAACCTCGTGAAAGAGGCACTGCGCAAATACCCCGGCTGGGTG
GGGTCCCGCCGGACGGTGCGGCCCGTACGACTCGGCGGTCACGACCTGCCCGCCGATGTG
GAGGTCATGTACAGCGCGTACGCCATCCAGCGCGACCCACGTTGGTACCCCGAACCCGAA
CGTCTCGACCCCGGCCGCTGGGAAACCAAGGGATCGAGCCGCGGAGTTCCCAAGGGGGCG
TGGGTGCCCTTCGCGCTCGGCACCTACAAATGCATCGGCGACAACTTCGCCCTTCTCGAG
ACGGCCGTTACGGTCGCGGTCGTCGCCTCCCACTGGCGACTACACGCCCTTCCGGGCGAC
GAGGTCCGGCCCAAGACGAAGGCCACTCACGTCTTCCCCAACCGACTCCGCATGATCGCT
GAACCGAGGAGTGTGGTGCGTCTGGAGGAGCCCGCCGCCATGGGAGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [273-286]  8.00000024242803e-05 PR00385 [307-318]  8.00000024242803e-05 PR00385 [382-391]  8.00000024242803e-05 PR00385 [391-402]  8.00000024242803e-05 PR00385
PR00385   P450
 [9-444]  1.10000000000001e-90 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [9-443]  5.6999970878395e-88 SSF48264
SSF48264   Cytochrome_P450
 [10-429]  1.29999999999998e-60 PF00067
PF00067   p450
IPR002403 Cytochrome P450, E-class, group IV (Family)
 [23-40]  2.70000183580794e-13 PR00465 [302-318]  2.70000183580794e-13 PR00465 [350-368]  2.70000183580794e-13 PR00465 [375-391]  2.70000183580794e-13 PR00465 [391-409]  2.70000183580794e-13 PR00465
PR00465   EP450IV
SignalP No significant hit
TMHMM No significant hit