close all open/close all

CDS information : Aver_00080


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction56,032 / 39,434 / - [in whole cluster]
50,034 / 33,436 / - [in contig]
Locationcomplement(39434..56032) [in whole cluster]
complement(33436..50034) [in contig]
TypeCDS
Length16,599 bp (5,532 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase AVES 3
Gene
Gene (GenBank)aveA3
EC number
Keyword
Note
Note (GenBank)
  • contains Ave module 7, module 8 and module 9; multifunctional polyketide synthase
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[11780788] Organization of biosynthetic gene cluster for avermectin in Streptomyces avermitilis: analysis of enzymatic domains in four polyketide synthases. (J Ind Microbiol Biotechnol. , 2001)

close this sectionPKS/NRPS Module

7 methylmalonyl-CoA
not conserved YASHS(S->C)
8 malonyl-CoA
9 methylmalonyl-CoA
not conserved YASHS(S->C)
KS38..413
AT603..921
dh976..1148
KR1488..1668
ACP1768..1838
KS1863..2241
AT2425..2743
DH2797..2969
KR3288..3468
ACP3568..3638
KS3662..4039
AT4211..4531
DH4585..4753
KR5085..5265
ACP5365..5435

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase AVES 3]
MDTSSEKLVDALRASLKANQTLRARNEQLAAAMEASSEPIAIVGMACRFPGGVCSPEELW
ELVASGGDAIGEFPAGRGWDLEGLFDSDPDRSGTSYARYGGFLYEAGEFDADFFGISPRE
ALAMDPQQRLLLETSWEAFERAGIDPLSMRGSRTGVFAGVMYHDYGSRLGTIPEGFEGYI
GNGSGGAVASGRVAYTLGLEGPAVSVDTACSSSLVALHLACQSLRSGECTLALAGGVTVM
STPHLFVEFSRQRGLSVDGRCKSFAGGADGTGMGEGVGMLLVERLSDAVRLGHRVLAVLR
GSAVNQDGASNGLTAPNGPAQERVIRQALANAGLSVADVDVVEGHGTGTTLGDPIEAQAL
LATYGQRAGNRPLWLGSVKSNIGHAQAAAGVGGVIKMVMALREGVLPRTLHVDEPSPQVD
WSAGAVRLLTEAVPWPGDAAGRLRRAGVSSFGVSGTNAHVILEEAPAAGGCVAGGGVLEG
APGLAISVAESVAAPVAVSAPVAESVPVPVPVPVPVPVSARSEAGLRAQAEALRQYVAVR
PDVSLADVGAGLACGRAVLEHRAVVLAADREELVQGLGALAAGEPDRRVTTGHAPGGDRG
GVVFVFPGQGGQWAGMGVRLLASSPVFARRMQACEEALAPWVDWSVVDILRRDAGDAVWE
RADVVQPVLFSVMVSLAALWRSYGIEPDAVLGHSQGEIAAAHVCGALSLKDAAKTVALRS
RALAAVRGRGGMASVPLPAQEVEQLIGERWAGRLWVAAVNGPRSTAVSGDAEAVDEVLAY
CAGTGVRARRIPVDYASHCPHVQPLREELLELLGDISPQPSGVPFFSTVEGTWLDTTTLD
AAYWYRNLHQPVRFSDAVQALADDGHRVFVEVSPHPTLVPAIEDTTEDTAEDVTAIGSLR
RGDNDTRRFLTALAHTHTTGIGTPTTWHHHYTHHHTHPHNHHLDLPTYPFQRQHYWLDAP
TGAGDVAAAGLEPAEHPLLAATVQLADTDGCLLTGRLSLRSHPWLGDYEVGGAVLLSGSA
FVELAVQVGERVGCTRIEQLTVHAPLVVPVGGGVSVQVGVAAADGEGRRLVSVYARGGSA
CGGGGASGGVWTCHASGVLVEAAAGGGVVVDGLAGVWPPRGAVAVDVDGVRDRLAGAGCV
LGPVFSGLRAVWRDGGDLLAEVCLPEEAWGDAAGFGLHPALLDGVVQPLSVLLPGGTGFG
EGAGFGEGVRVPAVWGGVSLHRAGVTGVRVRVWAVGRGGGREAVSVVVGDEAGVPVASVD
RLELRPVDMGQLRAVSVSAGRRGSLYAVQWAEVGPVPVCGQAWAWHEDVGESGGGPVPGV
VVLRCPDAGAGGGGGGGVGEVVGGVLGVVQGWLGLERFAGSRLVVVTRGAVVAGQEDGPV
DVVGAAVWGLVRSAQAEHPDRFVLLDLDTDTDTGTDLDTGAGAGAGAGWGVDGGHVAAVV
ACGEPQLAVRGERVLAARLTRLESSVDVPAQRSGDVAGREVLPWLSGGSVLVTGGTGVLG
AAVARHLAGVCGVRDLLLVSRRGPDAPGAEGLRAELAALGAEVRIVACDVGERREVVRLL
EGVPAGCPLTGVVHAAGVLDDATIASLTPERLGTVFAAKVDAALLLDELTRGMELSAFVL
FSSAAGILGSAGQGNYAAANAALDALAYRRRAAGLPGVSLAWGLWEEASGMTGHLAGTDH
RRIIRSGLHPMSTPDALALFDAALALDRPVLLPADLRPAPPLPPLLQDLLPATRRRTTRT
TTTGGADNGAQLHARLAGQTHEQQHTTLLALVRSHIATVLGHTTPDTIPPDRAFRDLGFD
SLTAVELRNRLSRTTGLRLPTTLAFDHPNPTTLTHHLHTQLLGSDSTASIPAPRAAAVPA
DQDEPVAIIGMACRYPGGVTSAEELWELLASGRDTVGEFPTDRGWDLEALFDPEPGRPGT
SYTRCGSFLYDAGEFDAGFFGISPREALAMDPQQRLLLEASWEAMEQAGIDPTTVRGSQT
GVFAGLIPQAYGPRLHENAAADTEGYVLTGTSGSVASGRISYTFGFEGPAVSVDTACSSS
LVALHLACQALRAGECSMALAGGVTVMSSPGAFVEFSRQRGLAADGHCKAFSAAADGTGW
GEGVGMLLVERLSDARRNGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAG
LSAGDVDAVEAHGTGTTLGDPIEAQALLATYGQDRAGEGPLWLGSVKSNVGHTQAAAGVA
GVIKMVMALRNGLLPRTLHVDEPSPHVDWSAGAVQLLTETVPWPGGEGRLRRAGVSSFGV
SGTNAHVILEEAPAHNIPSDTPADDVPGGPPAGEDAGSGEEAAAGSPGVWPWLVSAKSQP
ALRAQAQALHAHLTDHPGLDLADVGYTLAHARAVFDHRATLIAADRDTFLQALQALAAGE
PHPAVIHSSAPGGTGTGEAAGKTAFICSGQGTQRPGMAHGLYHTHPVFAAALNDICTHLD
PHLDHPLLPLLTQDPNTQDTTTLEEAAALLQQTPYAQPALFAFQVALHRLLTDGYHITPH
YYAGHSLGEITAAHLAGILTLTDATTLITQRATLMQTMPPGTMTTLHTTPHHITHHITAH
ENDLAIAAINTPTSLVISGTPHTVQHITTLCQQQGIKTKTLPTNHAFHSPHTNPILNQLH
QHTQTLTYHPPHTPLITANTPPDQLLTPHYWTQQARNTVDIATTTQTLHQHGVTTYIELG
PDNTLTTLTHHNLPNTPTTTLTLTHPHHHPQTHLLTNLAKTTTTWHPHHYTHHHNQPHTH
THLDLPTYPFQHHHYWLESTQPGAGNVSAAGLDPTEHPLLGATLELAEGDGCLLTGRLSL
RTHPWLAGHAVGGVVLLPGTAFAELALHAGESVGCDHVDELTLHTPLVIPEVGDVTLQVA
IAAPDESGRRMMTIHSRGEGGSGGADASASAWTRHAAGVLSPAKDDDTASYELLAGPWPP
VGATPVDLNTAYDQMADAGFAYGLAFQGLRAAWRYGDDILVEARLPEEVSGDAAAYGLHP
ALLDAALQGTGLLSVAGPGTPVVPHVWNGLRFRTHGAVSVRACLSTLGATGAAVCVRITD
DTGVPVASVDRLELRPVDMGQLRAVSVSAGRRGSLYAVQWAEVGPVPVCGQAWAWHEDVG
ESGGGPVPGVVVLRCPDAGADGGGGGGVGEVVGGVLGVVQGWLGLERFAGSRLVVVTRGA
VVAGPEDGPVDVVGAAVWGLVRSAQAEHPDRFVLLDLDTDLDSGADADAGNEAGMGSGLD
GGRVAAVVACGEPQLAVRGERVLAARLTRLESPVDVSGREVLPWLSGGSVLVTGGTGVLG
AAVARHLAGVCGVRDLLLVSRRGPDAPGAEGLRAELAALGAEVRIVACDVGERREVVRLL
EGVPAGCPLTGVVHAAGVLDDATIASLTPERLGTVFAAKVDAALLLDELTRGMELSAFVL
FSSAAGILGSAGQGNYAAANAALDALAYRRRAAGLPGVSLAWGLWEEASGMTGHLAGTDH
RRIIRSGLHPMSTPDALALFDAALALDRPVLLPADLRPAPPLPPLLQDLLPATRRRTTRT
TTTGGADNGAQLHARLAGQTHEQQHTTLLALVRSHIATVLGHNAPEMIPVDSAFRDLGFD
SLTAVELRNRLGEATGLRLPTSLVFDQPNAATLARHLRRELMGDDAEGETPSQVALHQVA
ADEPIAIVGMACRFPGGVCSPEELWELVASGGDAIGEFPAGRGWDLEGLFDSDPDRSGTS
YARYGGFLYEAGEFDADFFGISPREALAMDPQQRLLLETSWEAFERAGIDPLSMRGSRTG
VFAGVMYHDYAARLHHVPEGFEGLIANGSAGSVATGRVAYSFGLEGPAVTVDTACSSSLV
ALHWAAQALRAGECSMALAGGVTVMSSPGTFVEFSRQRGLAADGRCKAYSAAADGTGWAE
GVGMLLVERLSDARRNGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAGLT
PADVDAVEGHGTGTTLGDPIEAQALLAAYGQHRPHHRPLWLGSLKSNIGHAQAAAGVGGV
IKMVMALRNGLLPQTLHVDEPTPQVDWSTGAVQLLTQPVPWPADPAGRPRHAGVSSFGVS
GTNAHVILEEAPAAAGGAAGGGVSVGAPNPALPVAESEPVPVPVPVSARSEAGLRAQAQA
LRQYVAARPDMSPADIGAGLARGRAVLEHRAVILAADREELAQALTALAAGEPHPHITTG
HTRGSDRGGVVFVFPGQGGQWAGMGLTLLTSSPVFAEHIDACEKALTPWVPWSLTDILHR
DPDDPAWQQADVVQPVLFSIMVSLAALWRSYGIEPDAVLGHSQGEIAAAHICGALSLKDA
AKTVALRSQALAAVRGRGAMVSLPLPAQDVQQLISERWEGQLWVAALNGPHSTTVSGDTT
AVEELLTHCADTGLRAKRIPVDYASHCPHVQPLHDELLHLLGDITPQPSTMPFFSTVVGH
LVWYTTTLDAAYWYRNLHQPVRFSHAIQTLTDDGHRPFIEISPHPTLVPAIEDTTENTTE
NITATGSLRRGDNDTHRFLTALAHTHTTGIRTPTTWHHHYTQTHPHPHNHHLDLPTYPFQ
HQHYWLQPPTTTTDLTTTGLTPTHHPLLTATLTLANNNTQLLTGRLSLRTHPWLTDHTVV
GTTLVPGTALLELALQATTTDHLEELALHTPLVIPREGAVDVQVHINPPDDTDTRSLTIY
SRSENAPAAAPWRHHATAVLGTKTSRIETGRSHDDLSMWPPAGAVRCADEELAALYGDYE
ANGFVYGPAFRGLTAAWRLGDEVFAEVRLPEQVHGEASAYNLHPALLDAALHAAAFAPSG
SLPQGSVPFSFTGVTLHAANASSLRVRLSPADPNSGHAAVSVLVTDDTGTPVASVEALAV
RPLAADELRAAERAVQRAELFDMKWVEVPSDVLVSGGASVVVLDGADDLVGLAAEEDGVP
GVVVLRCPDAGADGGGGGGGVGEVVGGVLGVVQGWLGLERFAGSRLVVVTRGAVVAGPED
GPVDGPVDVVGAAVWGLVRSAQAEHPDRFVLLDLDTDLDSGADRDAGNEAGMGSGLDGGR
VAAVVACGEPQLAVRGERVLAARLTRLESPVDVSGREVLPWLSGGSVLVTGGTGVLGAAV
ARHLAGVCGVRDLLLVSRRGPDAPGAEGLRAELAALGAEVRIVACDVGERREVVRLLEGV
PAGCPLTGVVHAAGVLDDATIASLTPERLGTVFAAKVDAALLLDELTRGMELSAFVLFSS
AAGILGSAGQGNYAAANAALDALAYRRRAAGLPGVSLAWGLWEEASGMTGHLAGTDHRRI
IRSGLHPMSTPDALALFDAALALDRPVLLPADLRPAPPLPPLLQDLLPATRRRTTRTTTT
GGADNGAQLHGRLAGQTHEQQHTTLLALVRSHIATVLGHTTPDTIPPDRAFRDLGFDSLT
AVELRNRLSHTTGLRLPTTLAFDHPNPTTLTHHLHTQLVSKGLTAAAEPDAATTPPGLPS
LLSELERLEAVVLSSTTSSAAPLDDGARTRLASRLHSLAQKLNGDDTAPDLAETSDEEMF
ALIDREVGFESQ
selected fasta
>polyketide synthase [type I polyketide synthase AVES 3]
ATGGACACGTCCAGCGAAAAGCTCGTCGACGCGCTTAGGGCGTCTCTGAAGGCGAACCAG
ACCCTGCGGGCACGTAATGAGCAACTGGCAGCCGCCATGGAGGCGTCCAGCGAGCCGATT
GCGATTGTGGGGATGGCGTGTCGTTTTCCGGGTGGGGTGTGTTCGCCGGAGGAGTTGTGG
GAGCTGGTTGCGTCGGGTGGGGATGCGATTGGTGAATTTCCGGCCGGTCGGGGGTGGGAT
CTGGAGGGGTTGTTTGATTCGGACCCTGACCGGTCGGGGACGTCGTACGCGCGGTATGGC
GGGTTTTTGTATGAGGCGGGGGAGTTCGATGCGGACTTCTTCGGGATCAGTCCGCGTGAG
GCGTTGGCGATGGATCCGCAGCAGCGGTTGTTGCTGGAGACGTCGTGGGAGGCGTTCGAG
CGGGCGGGTATCGATCCGCTGTCGATGCGTGGCTCCCGTACGGGTGTCTTCGCCGGGGTG
ATGTACCACGACTACGGATCCCGCCTGGGTACCATCCCCGAGGGATTCGAGGGCTACATC
GGCAACGGTAGCGGCGGCGCCGTCGCGTCGGGCCGCGTCGCCTACACGCTCGGTCTCGAG
GGCCCTGCCGTCTCGGTGGACACGGCATGTTCGTCGTCGTTGGTGGCGCTGCATCTGGCG
TGCCAGTCGCTGCGGTCGGGTGAGTGCACGCTCGCGCTGGCCGGCGGTGTGACGGTGATG
TCGACCCCGCACCTCTTCGTCGAGTTCTCACGCCAGCGCGGACTGTCGGTGGACGGCCGC
TGCAAGTCCTTCGCGGGTGGAGCCGACGGCACCGGCATGGGCGAGGGCGTCGGGATGCTG
TTGGTGGAGCGGTTGTCGGATGCGGTGCGGCTGGGGCATCGGGTGCTGGCGGTGCTGCGC
GGCAGTGCGGTCAATCAGGACGGTGCGTCGAATGGGTTGACGGCGCCGAATGGTCCGGCT
CAGGAGCGGGTGATCCGGCAGGCGTTGGCGAACGCGGGGTTGTCCGTGGCGGATGTGGAT
GTGGTGGAGGGGCATGGGACGGGCACGACGCTGGGTGATCCGATCGAGGCGCAGGCGTTG
CTCGCCACGTACGGGCAGCGGGCCGGTAACAGGCCGCTGTGGCTGGGATCGGTGAAGTCG
AACATCGGCCATGCGCAGGCTGCCGCGGGTGTGGGTGGGGTCATCAAGATGGTGATGGCG
TTGCGGGAGGGGGTGTTGCCGCGGACGTTGCATGTGGATGAGCCGTCGCCGCAGGTGGAC
TGGTCCGCGGGGGCGGTGCGGCTGCTGACGGAGGCGGTGCCGTGGCCGGGGGACGCGGCA
GGGCGGTTGCGGCGGGCGGGAGTGTCGTCGTTCGGGGTCAGTGGCACGAATGCGCATGTG
ATTTTGGAGGAGGCGCCGGCGGCGGGGGGCTGTGTTGCCGGGGGTGGGGTGTTGGAGGGT
GCTCCGGGTCTTGCCATTTCGGTGGCTGAGTCGGTGGCCGCTCCAGTGGCTGTGTCTGCG
CCGGTGGCTGAGTCGGTGCCGGTGCCGGTGCCGGTGCCGGTTCCTGTGCCGGTGTCGGCT
AGGTCTGAGGCTGGGTTGCGGGCGCAGGCGGAGGCGTTGCGTCAGTACGTGGCAGTCCGG
CCGGACGTTTCGCTTGCCGATGTGGGTGCGGGTCTGGCCTGTGGGCGGGCTGTGCTGGAG
CATCGTGCGGTCGTCCTGGCCGCGGACCGTGAGGAGCTGGTGCAAGGGTTGGGGGCGCTG
GCGGCGGGTGAGCCGGATCGGCGGGTGACCACGGGTCATGCGCCGGGTGGTGACCGGGGC
GGTGTCGTCTTCGTGTTTCCCGGACAGGGTGGGCAGTGGGCCGGGATGGGTGTGCGTCTG
CTCGCCTCCTCTCCGGTGTTCGCCCGGCGGATGCAGGCGTGCGAGGAGGCTCTGGCGCCG
TGGGTGGACTGGTCTGTGGTGGACATCCTGCGCCGGGACGCGGGGGATGCGGTGTGGGAG
CGGGCCGATGTGGTCCAGCCTGTGCTGTTCAGCGTCATGGTGTCTTTGGCTGCTCTGTGG
CGTTCCTACGGTATCGAACCCGACGCGGTCCTTGGCCATTCCCAGGGCGAGATCGCGGCC
GCGCATGTGTGTGGGGCGCTGAGCCTGAAGGACGCGGCGAAGACTGTTGCGCTGCGCAGC
CGGGCGCTGGCCGCTGTGCGGGGCCGGGGCGGCATGGCCTCAGTGCCGCTGCCTGCCCAG
GAGGTGGAGCAGCTCATTGGTGAGCGGTGGGCGGGGCGGTTGTGGGTGGCGGCGGTCAAC
GGCCCCCGCTCCACCGCCGTCTCGGGGGATGCCGAGGCGGTGGACGAGGTGCTGGCGTAC
TGTGCCGGCACCGGGGTGCGGGCCCGGCGGATCCCGGTCGACTATGCCTCGCACTGCCCC
CATGTGCAGCCCCTGCGGGAGGAGTTGCTGGAGCTGCTGGGGGACATCAGCCCGCAGCCG
TCCGGCGTGCCGTTCTTCTCCACGGTGGAGGGCACCTGGCTGGACACCACAACCCTGGAC
GCCGCCTACTGGTACCGCAACCTGCACCAGCCTGTCCGTTTCAGCGATGCCGTCCAGGCC
CTGGCGGATGACGGACACCGCGTCTTCGTCGAAGTCAGCCCCCACCCCACCCTCGTCCCC
GCCATCGAAGACACCACCGAAGACACCGCCGAAGACGTCACCGCGATCGGCAGCCTCCGC
CGCGGCGACAACGACACCCGCCGCTTCCTCACCGCCCTCGCCCACACCCACACCACCGGC
ATCGGCACACCCACCACCTGGCACCACCACTACACCCACCACCACACCCACCCCCACAAC
CACCACCTCGACCTCCCCACTTATCCCTTCCAACGCCAGCACTACTGGCTCGACGCTCCC
ACGGGAGCAGGTGACGTCGCCGCTGCTGGCTTGGAGCCGGCCGAACACCCTCTGCTCGCG
GCAACAGTCCAACTCGCAGACACGGACGGCTGCCTACTGACGGGTCGCCTGTCCTTGCGC
TCGCATCCGTGGCTGGGCGATTACGAGGTGGGGGGTGCGGTCCTGCTGTCGGGGTCGGCG
TTCGTGGAGCTGGCGGTCCAGGTTGGCGAACGCGTGGGCTGCACCCGAATCGAGCAACTC
ACTGTGCATGCGCCGCTGGTGGTTCCTGTGGGTGGGGGTGTGAGTGTGCAGGTTGGGGTT
GCGGCTGCGGATGGGGAGGGGCGGCGTTTGGTGAGTGTGTATGCGCGGGGTGGGAGTGCT
TGTGGTGGGGGTGGTGCGTCGGGTGGGGTGTGGACGTGTCATGCCTCGGGGGTGCTGGTT
GAGGCTGCTGCTGGTGGTGGTGTGGTGGTGGATGGTCTGGCGGGGGTGTGGCCGCCGCGG
GGTGCGGTGGCGGTGGATGTCGATGGTGTCCGTGACCGTTTGGCTGGGGCTGGTTGTGTT
TTGGGGCCGGTGTTTTCGGGGCTGCGTGCGGTGTGGCGTGATGGGGGGGATTTGCTGGCT
GAGGTGTGTCTGCCGGAGGAGGCGTGGGGTGATGCGGCTGGTTTTGGGCTGCATCCGGCG
TTGCTGGATGGTGTGGTCCAGCCGTTGTCGGTGTTGCTTCCGGGTGGGACGGGGTTTGGG
GAGGGGGCGGGGTTCGGGGAGGGTGTTCGGGTGCCGGCTGTGTGGGGTGGTGTGTCGCTT
CACCGGGCGGGTGTGACCGGTGTGCGGGTGCGTGTGTGGGCTGTAGGGCGGGGCGGCGGG
CGTGAGGCGGTGTCGGTCGTGGTCGGGGATGAGGCGGGTGTGCCGGTGGCGTCGGTCGAT
CGTCTTGAGTTGCGGCCTGTGGATATGGGTCAGTTGCGTGCTGTCTCGGTTTCGGCGGGG
CGGCGGGGTTCGCTGTATGCGGTGCAGTGGGCTGAGGTGGGTCCTGTGCCGGTGTGTGGG
CAGGCGTGGGCGTGGCACGAGGACGTGGGTGAGAGCGGTGGTGGGCCTGTGCCGGGGGTG
GTGGTGTTGCGGTGCCCGGATGCCGGTGCCGGTGGCGGCGGTGGCGGTGGTGTGGGTGAG
GTTGTTGGTGGGGTGTTGGGTGTGGTGCAGGGGTGGCTGGGGCTGGAGCGGTTTGCGGGT
TCGCGGCTGGTGGTGGTGACCCGGGGTGCGGTGGTGGCCGGCCAAGAAGACGGCCCGGTG
GATGTGGTGGGTGCGGCGGTGTGGGGGCTGGTGCGGTCGGCGCAGGCTGAGCATCCGGAC
CGGTTTGTCCTCCTCGACCTCGACACCGACACCGACACCGGCACCGACCTCGACACCGGT
GCTGGTGCTGGTGCTGGTGCTGGTTGGGGCGTGGATGGTGGGCATGTGGCGGCGGTGGTG
GCGTGTGGTGAGCCGCAGTTGGCGGTGCGTGGTGAGCGGGTGCTGGCCGCACGCCTGACG
CGACTTGAGTCGTCCGTTGATGTACCTGCTCAGCGGTCCGGTGATGTTGCTGGTCGGGAG
GTGTTGCCGTGGTTGTCGGGTGGGTCGGTGTTGGTGACGGGTGGGACGGGTGTGCTGGGT
GCGGCGGTGGCGCGGCATCTGGCTGGTGTGTGTGGGGTGCGGGATCTGCTGTTGGTGAGC
CGGCGTGGTCCGGATGCTCCGGGTGCGGAGGGTTTGCGGGCGGAGCTGGCCGCGTTGGGG
GCGGAGGTGCGGATTGTTGCGTGTGATGTGGGGGAGCGGCGGGAGGTGGTCCGGCTGCTG
GAGGGTGTTCCTGCCGGGTGTCCGCTGACGGGTGTCGTGCATGCGGCTGGTGTGCTGGAC
GATGCGACGATCGCCTCTCTCACGCCCGAGCGGCTGGGCACGGTGTTCGCGGCCAAGGTG
GATGCCGCTCTTTTGCTGGATGAGCTGACGCGGGGTATGGAGCTGTCGGCGTTCGTGCTG
TTCTCCTCGGCCGCGGGGATCCTGGGGTCGGCCGGGCAGGGCAACTACGCCGCGGCCAAT
GCCGCTCTGGACGCGCTGGCGTACCGGCGGCGGGCGGCGGGTCTGCCGGGGGTGTCGCTG
GCGTGGGGGCTGTGGGAAGAGGCCAGCGGGATGACCGGGCACCTGGCCGGCACCGACCAC
CGGCGCATCATCCGTTCCGGTCTGCATCCCATGTCGACCCCGGACGCACTGGCTCTCTTC
GATGCGGCCCTGGCTCTGGACCGGCCGGTCCTGCTGCCCGCCGACCTGCGTCCCGCCCCG
CCCCTGCCGCCCCTGCTGCAGGACCTCCTGCCCGCCACCCGCCGCCGCACCACCCGCACC
ACCACTACCGGTGGTGCGGACAACGGCGCCCAGCTGCATGCCCGGCTGGCCGGCCAGACA
CACGAACAACAGCACACCACCCTCCTCGCCCTGGTCCGCTCCCACATCGCCACCGTCCTC
GGCCACACCACCCCCGACACCATCCCCCCCGACCGCGCGTTCCGCGACCTCGGCTTCGAC
TCCCTCACCGCCGTCGAACTACGCAACCGGCTCTCCCGCACCACCGGACTCCGCCTCCCC
ACCACCCTCGCCTTCGACCACCCCAACCCCACCACCCTCACCCACCACCTCCACACACAA
CTTCTGGGCTCGGACAGCACTGCCTCCATCCCAGCTCCCCGTGCTGCGGCTGTGCCTGCA
GACCAGGACGAGCCCGTCGCGATCATTGGCATGGCGTGCCGCTATCCCGGAGGCGTCACC
TCAGCCGAGGAGCTGTGGGAACTGCTCGCATCGGGGAGGGACACGGTCGGCGAGTTTCCG
ACGGACCGTGGGTGGGACCTGGAAGCACTGTTCGATCCGGAACCGGGTCGGCCGGGCACC
TCGTACACCCGCTGTGGGAGTTTCCTCTACGACGCGGGGGAGTTCGACGCCGGCTTCTTC
GGGATCAGTCCGCGTGAGGCACTGGCGATGGACCCGCAGCAGCGATTGCTGCTGGAGGCC
TCATGGGAGGCCATGGAGCAGGCAGGTATTGACCCTACGACCGTACGCGGGAGCCAGACA
GGCGTGTTCGCGGGCCTCATTCCGCAGGCCTATGGACCCAGGCTGCACGAAAACGCCGCA
GCCGACACCGAGGGCTATGTCCTGACCGGCACATCCGGGAGTGTGGCCTCCGGTCGTATC
TCGTACACGTTTGGTTTTGAGGGTCCTGCGGTGTCGGTGGACACGGCTTGTTCCTCGTCG
TTGGTGGCTTTACATCTGGCCTGTCAGGCGTTGCGTGCGGGTGAGTGCTCGATGGCGCTT
GCCGGGGGTGTGACGGTGATGTCGTCTCCGGGTGCCTTCGTGGAGTTTTCGCGGCAGCGG
GGTCTGGCCGCGGACGGGCATTGCAAGGCGTTCTCGGCGGCGGCGGACGGGACCGGCTGG
GGTGAGGGTGTGGGGATGCTGCTGGTGGAGCGGCTCTCCGACGCCCGTCGCAACGGTCAC
CGTGTCCTGGCCGTGGTGCGTGGCAGTGCGGTCAACCAGGACGGTGCGAGCAACGGGCTG
ACCGCGCCCAACGGGCCCTCCCAGCAGCGTGTCATCCGCCAGGCCCTCGCCAACGCCGGC
TTGTCGGCCGGTGATGTCGATGCGGTGGAGGCCCACGGCACCGGCACCACTTTGGGCGAC
CCGATCGAGGCCCAGGCCCTCCTTGCGACCTACGGGCAGGACCGTGCCGGCGAGGGGCCG
CTGTGGCTGGGCTCGGTCAAGTCCAATGTCGGTCACACACAGGCTGCCGCGGGCGTCGCC
GGGGTGATCAAGATGGTGATGGCGCTGCGGAATGGTCTGCTGCCGCGGACGTTGCATGTG
GATGAGCCGTCGCCGCATGTGGACTGGTCCGCGGGTGCGGTGCAGCTGCTGACGGAGACG
GTGCCCTGGCCCGGCGGGGAGGGGCGGCTACGGCGGGCAGGAGTGTCATCATTCGGCGTC
AGCGGCACCAACGCCCACGTCATCCTCGAAGAAGCACCCGCCCACAACATCCCGTCAGAC
ACACCCGCCGACGACGTTCCGGGGGGACCACCCGCCGGCGAGGATGCCGGTAGTGGCGAG
GAGGCTGCTGCCGGCAGTCCAGGGGTGTGGCCGTGGCTGGTGTCGGCCAAGTCGCAGCCG
GCCCTGCGCGCCCAGGCCCAGGCCCTGCACGCCCACCTCACCGACCACCCCGGCCTCGAC
CTCGCCGACGTCGGATACACCCTCGCCCACGCCCGCGCCGTGTTCGACCACCGCGCCACC
CTCATCGCCGCCGACCGCGACACCTTCCTGCAAGCACTCCAGGCACTCGCCGCAGGCGAA
CCCCACCCCGCCGTCATCCACAGCAGCGCCCCAGGCGGGACCGGGACCGGGGAGGCCGCA
GGAAAGACCGCATTCATCTGCTCCGGACAGGGCACCCAACGCCCCGGCATGGCCCACGGC
CTCTACCACACCCACCCCGTCTTCGCCGCCGCACTCAACGACATCTGCACCCACCTCGAC
CCCCACCTCGACCACCCCCTCCTCCCCCTCCTCACCCAGGACCCCAACACCCAGGACACC
ACCACCCTCGAAGAAGCGGCCGCACTGCTCCAGCAGACCCCGTACGCCCAGCCCGCCCTC
TTCGCCTTCCAGGTCGCCCTCCACCGCCTCCTCACCGACGGCTACCACATCACCCCCCAC
TACTACGCCGGACACTCCCTCGGCGAAATCACCGCCGCCCACCTCGCCGGCATCCTCACC
CTCACCGACGCCACCACCCTCATCACCCAACGCGCCACCCTCATGCAAACCATGCCCCCC
GGCACCATGACCACCCTCCACACCACCCCCCACCACATCACCCACCACATCACCGCCCAC
GAAAACGACCTCGCCATCGCCGCCATCAACACCCCCACCTCCCTCGTCATCAGCGGCACC
CCCCACACCGTCCAACACATCACCACCCTCTGCCAACAACAAGGCATCAAAACCAAAACC
CTCCCCACCAACCACGCCTTCCACTCCCCCCACACCAACCCCATCCTCAACCAACTCCAC
CAGCACACCCAAACCCTCACCTACCACCCACCCCACACCCCCCTCATCACCGCCAACACC
CCACCCGACCAACTCCTCACCCCCCACTACTGGACCCAACAAGCCCGCAACACCGTCGAC
ATAGCCACCACCACCCAAACCCTCCACCAACACGGCGTCACCACCTACATCGAACTCGGA
CCCGACAACACCCTCACCACCCTCACCCACCACAACCTCCCCAACACCCCCACCACCACC
CTCACCCTCACCCACCCCCACCACCACCCCCAAACCCACCTCCTCACCAACCTCGCCAAA
ACCACCACCACCTGGCACCCCCACCACTACACCCACCACCACAACCAACCCCACACCCAC
ACCCACCTCGACCTCCCCACCTACCCCTTCCAACACCACCACTACTGGCTCGAAAGCACA
CAGCCCGGTGCCGGCAACGTGTCAGCAGCCGGACTCGACCCCACCGAACACCCCCTACTC
GGCGCCACATTGGAACTGGCCGAAGGGGACGGCTGCCTACTGACGGGGCGCCTCTCGTTG
CGCACGCATCCCTGGCTCGCCGGCCATGCGGTAGGCGGTGTCGTGCTGCTGCCGGGTACG
GCCTTCGCGGAACTGGCCCTTCATGCCGGAGAAAGTGTGGGTTGCGACCACGTGGACGAG
CTGACGCTCCACACACCGTTGGTCATTCCTGAGGTCGGAGACGTGACCCTTCAGGTTGCC
ATTGCGGCGCCGGACGAGTCGGGTCGCCGCATGATGACCATCCACTCACGCGGTGAGGGC
GGCAGTGGTGGAGCCGATGCGTCGGCCAGTGCGTGGACGCGTCATGCCGCGGGTGTGCTG
AGCCCTGCCAAGGACGATGACACTGCCTCGTACGAGCTGCTTGCGGGACCCTGGCCTCCC
GTTGGAGCTACGCCTGTCGACCTGAACACGGCTTACGATCAAATGGCCGACGCCGGCTTT
GCTTATGGCCTGGCATTCCAAGGGTTGCGCGCGGCCTGGCGCTACGGCGACGACATCCTC
GTCGAGGCACGTCTTCCCGAAGAAGTGTCGGGAGACGCGGCGGCGTACGGTCTGCACCCG
GCCCTGCTCGACGCTGCCCTTCAGGGCACCGGCCTGCTTTCTGTGGCGGGTCCGGGGACG
CCCGTCGTGCCCCATGTGTGGAACGGTCTGCGGTTCCGTACGCATGGTGCAGTCTCCGTG
CGCGCGTGCCTGTCGACGCTTGGAGCGACAGGGGCGGCCGTGTGCGTGCGCATCACCGAC
GACACCGGGGTGCCGGTGGCGTCGGTCGATCGTCTTGAGTTGCGGCCTGTGGATATGGGT
CAGTTGCGTGCTGTCTCGGTTTCGGCGGGGCGGCGGGGTTCGCTGTATGCGGTGCAGTGG
GCTGAGGTGGGTCCTGTGCCGGTGTGTGGGCAGGCGTGGGCGTGGCACGAGGACGTGGGT
GAGAGCGGTGGTGGGCCTGTGCCGGGGGTGGTGGTGTTGCGGTGCCCGGATGCCGGTGCC
GATGGCGGCGGTGGCGGTGGTGTGGGTGAGGTTGTTGGTGGGGTGTTGGGTGTGGTGCAG
GGGTGGCTGGGGCTGGAGCGGTTTGCGGGTTCGCGGCTGGTGGTGGTGACCCGGGGTGCG
GTGGTGGCCGGCCCGGAGGACGGCCCGGTGGATGTGGTGGGTGCGGCGGTGTGGGGGCTG
GTGCGGTCGGCGCAGGCTGAGCATCCGGACCGGTTTGTCCTCCTCGACCTGGACACCGAC
CTCGACAGCGGCGCTGACGCCGATGCCGGCAACGAGGCCGGTATGGGGTCTGGTCTGGAT
GGTGGGCGTGTGGCTGCGGTGGTGGCGTGTGGTGAGCCGCAGTTGGCGGTGCGTGGTGAG
CGGGTGCTGGCCGCACGCCTGACACGACTTGAGTCGCCGGTTGATGTATCGGGTCGGGAG
GTGTTGCCGTGGTTGTCGGGTGGGTCGGTGTTGGTGACGGGTGGGACGGGTGTGCTGGGT
GCGGCGGTGGCGCGGCATCTGGCTGGTGTGTGTGGGGTGCGGGATCTGTTGTTGGTGAGC
CGGCGTGGTCCGGATGCTCCGGGTGCGGAGGGTTTGCGGGCGGAGCTGGCCGCGTTGGGG
GCGGAGGTGCGGATTGTTGCGTGTGATGTGGGGGAGCGGCGGGAGGTGGTCCGGCTGCTG
GAGGGTGTTCCTGCCGGGTGTCCGCTGACGGGTGTCGTGCATGCGGCTGGTGTGCTGGAC
GATGCGACGATCGCCTCTCTCACGCCCGAGCGGCTGGGCACGGTGTTCGCGGCCAAGGTG
GATGCCGCTCTTTTGCTGGATGAGCTGACGCGGGGTATGGAGCTGTCGGCGTTCGTGCTG
TTCTCCTCGGCCGCGGGGATCCTGGGGTCGGCCGGGCAGGGCAACTACGCCGCGGCCAAT
GCCGCTCTGGACGCGCTGGCGTACCGGCGGCGGGCGGCGGGTCTGCCGGGGGTGTCGCTG
GCGTGGGGGCTGTGGGAAGAGGCCAGCGGGATGACCGGGCACCTGGCCGGCACCGACCAC
CGGCGCATCATCCGTTCCGGTCTGCATCCCATGTCGACCCCGGACGCACTGGCTCTCTTC
GATGCGGCCCTGGCTCTGGACCGGCCGGTCCTGCTGCCCGCCGACCTGCGTCCCGCCCCG
CCCCTGCCGCCCCTGCTGCAGGACCTCCTGCCCGCCACCCGCCGCCGCACCACCCGCACC
ACCACTACCGGTGGTGCGGACAACGGCGCCCAGCTGCATGCCCGGCTGGCCGGCCAGACA
CACGAACAACAGCACACCACCCTCCTCGCCCTGGTCCGCTCCCACATCGCCACCGTCCTC
GGCCACAACGCGCCGGAGATGATCCCCGTTGACTCGGCGTTCCGCGACCTAGGCTTCGAC
TCCTTGACAGCGGTGGAACTCCGTAACCGCCTGGGTGAGGCAACGGGACTGCGACTGCCG
ACCAGTCTGGTCTTCGACCAGCCGAATGCAGCGACCCTGGCGCGTCACCTACGTCGTGAG
CTGATGGGCGACGACGCGGAAGGCGAGACGCCATCGCAGGTCGCACTTCATCAGGTTGCC
GCGGATGAGCCGATTGCGATTGTGGGGATGGCGTGTCGTTTTCCGGGTGGGGTGTGTTCG
CCGGAGGAGTTGTGGGAGCTGGTTGCGTCGGGTGGGGATGCGATTGGTGAATTTCCGGCC
GGTCGGGGGTGGGATCTGGAGGGGTTGTTTGATTCGGACCCTGACCGGTCGGGGACGTCG
TACGCGCGGTATGGCGGGTTTTTGTATGAGGCGGGGGAGTTCGATGCGGACTTCTTCGGG
ATCAGTCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGCGGTTGTTGCTGGAGACGTCG
TGGGAGGCGTTCGAGCGGGCGGGTATCGATCCGCTGTCGATGCGTGGCTCCCGTACGGGT
GTCTTCGCCGGGGTGATGTACCACGACTACGCCGCGCGTCTCCACCATGTCCCCGAGGGT
TTCGAAGGCCTCATCGCCAACGGCAGCGCAGGCAGCGTCGCGACCGGCCGGGTGGCCTAC
AGCTTTGGCCTTGAGGGTCCGGCCGTGACCGTCGATACGGCGTGTTCGTCGTCGTTGGTG
GCGTTGCATTGGGCGGCGCAGGCGTTGCGTGCGGGTGAGTGTTCGATGGCGCTTGCCGGG
GGTGTGACGGTGATGTCGTCTCCGGGTACGTTTGTGGAGTTCTCACGTCAGCGGGGTCTG
GCCGCGGACGGGCGGTGCAAGGCCTATTCGGCGGCTGCTGACGGTACCGGCTGGGCCGAG
GGTGTGGGGATGCTGCTGGTGGAGCGGCTCTCCGACGCCCGTCGCAACGGTCACCGTGTC
CTGGCCGTGGTGCGTGGCAGTGCGGTCAACCAGGACGGTGCGAGCAACGGTCTGACCGCG
CCCAACGGGCCCTCCCAGCAGCGTGTCATCCGTCAGGCCCTGGCCAATGCGGGACTGACC
CCGGCCGATGTCGACGCAGTGGAGGGCCACGGCACCGGGACCACTCTGGGGGACCCGATC
GAGGCCCAGGCACTCCTGGCCGCCTACGGACAACACCGCCCCCACCACCGCCCCTTGTGG
CTGGGATCCCTCAAATCCAACATCGGGCACGCACAGGCCGCCGCGGGCGTGGGCGGAGTC
ATCAAGATGGTGATGGCCCTGCGCAACGGGCTGCTGCCACAGACCCTCCACGTGGACGAG
CCCACCCCCCAGGTCGACTGGTCCACAGGCGCAGTACAACTCCTGACACAACCGGTGCCC
TGGCCCGCCGACCCGGCCGGCCGGCCACGCCACGCCGGCGTGTCATCATTCGGCGTCAGC
GGCACCAACGCCCATGTGATTTTGGAGGAGGCGCCTGCGGCGGCGGGCGGTGCTGCCGGT
GGTGGGGTGTCGGTGGGTGCTCCGAATCCAGCCCTTCCGGTGGCTGAGTCTGAGCCGGTG
CCGGTGCCGGTGCCGGTGTCGGCGAGGTCTGAGGCCGGGTTGCGGGCGCAGGCACAGGCG
TTGCGCCAGTACGTGGCAGCCCGCCCGGACATGTCACCTGCCGACATCGGTGCGGGTCTG
GCCCGCGGCCGGGCCGTACTGGAACACCGCGCCGTCATCCTGGCCGCGGACCGCGAGGAA
CTGGCGCAGGCACTGACAGCCCTGGCAGCCGGCGAACCCCACCCCCACATCACCACAGGC
CACACCCGGGGCAGTGACCGCGGCGGCGTCGTCTTCGTCTTCCCCGGACAGGGCGGCCAG
TGGGCCGGGATGGGCCTGACCCTGCTCACCTCCTCACCCGTGTTCGCCGAACACATCGAC
GCATGCGAGAAAGCCCTCACCCCCTGGGTGCCCTGGTCCCTGACCGACATCCTGCACCGC
GACCCCGACGACCCCGCATGGCAACAAGCCGACGTGGTCCAGCCCGTGCTCTTCAGCATC
ATGGTCTCCCTCGCCGCCCTGTGGCGCTCCTACGGCATCGAACCCGACGCGGTCCTCGGC
CACTCCCAGGGAGAAATCGCCGCCGCCCACATCTGCGGCGCACTCAGCCTGAAAGACGCC
GCCAAAACCGTTGCACTGCGCAGCCAGGCACTGGCCGCCGTACGAGGCCGGGGCGCCATG
GTCTCACTGCCCCTGCCCGCCCAGGACGTGCAGCAGCTCATTTCCGAACGGTGGGAAGGG
CAGTTGTGGGTGGCAGCCCTCAACGGCCCCCACTCCACCACCGTCTCCGGCGACACCACC
GCAGTAGAAGAACTCCTCACCCACTGTGCCGACACCGGCCTACGGGCCAAACGCATCCCC
GTCGACTACGCCTCCCACTGCCCCCACGTCCAACCCCTCCACGACGAACTCCTGCACCTG
CTGGGAGACATCACCCCCCAGCCGTCCACCATGCCGTTCTTCTCCACCGTCGTAGGGCAC
CTGGTCTGGTACACCACAACCCTGGACGCCGCCTACTGGTACCGCAACCTCCACCAGCCC
GTCCGCTTCAGCCACGCCATCCAGACCCTGACCGACGACGGACACCGCCCCTTCATCGAA
ATCAGTCCCCACCCCACCCTCGTCCCCGCCATCGAAGACACCACCGAAAACACCACCGAA
AACATCACCGCGACCGGCAGCCTCCGCCGCGGCGACAACGACACCCACCGCTTCCTCACC
GCCCTCGCCCACACCCACACCACCGGCATTCGGACACCCACCACCTGGCACCACCACTAC
ACCCAAACCCACCCCCACCCCCACAACCACCACCTCGACCTGCCCACCTACCCCTTCCAA
CACCAGCACTACTGGCTCCAACCACCCACCACGACAACCGACCTCACCACCACCGGCCTC
ACCCCCACCCACCACCCCCTCCTCACCGCAACACTCACCCTCGCCAACAACAACACACAA
CTACTCACCGGCCGCCTCTCCCTACGCACCCACCCCTGGCTCACCGACCACACCGTCGTC
GGTACCACTCTTGTGCCAGGAACCGCCCTCCTCGAACTCGCCCTCCAAGCAACCACGACC
GACCACCTCGAAGAACTCGCCCTCCACACGCCTCTCGTCATCCCCCGTGAGGGTGCCGTC
GACGTTCAGGTGCACATCAATCCACCGGACGACACCGACACTCGTTCACTGACGATCTAC
TCGCGAAGCGAGAACGCCCCCGCAGCGGCTCCCTGGCGTCATCACGCCACGGCCGTTCTG
GGAACCAAGACCTCGCGCATTGAGACAGGCCGTAGCCACGATGATCTGTCGATGTGGCCG
CCAGCGGGCGCAGTTCGCTGTGCTGATGAGGAATTGGCAGCCTTGTATGGCGACTACGAG
GCAAATGGCTTTGTCTATGGCCCCGCATTCCGGGGGCTGACTGCTGCCTGGCGTCTGGGA
GACGAGGTGTTTGCCGAGGTTCGCCTTCCAGAACAGGTGCACGGCGAGGCATCCGCGTAC
AACCTGCACCCGGCACTGCTGGATGCTGCCTTGCACGCAGCGGCCTTTGCGCCGTCGGGC
AGTCTGCCGCAGGGATCCGTACCGTTCTCCTTCACCGGTGTGACGCTGCACGCCGCCAAT
GCGTCGTCGTTGCGCGTGCGACTCTCGCCGGCCGATCCGAACAGCGGCCACGCCGCAGTT
TCCGTGCTGGTCACGGATGACACCGGTACGCCCGTGGCGTCCGTCGAGGCGTTGGCGGTG
CGCCCGTTGGCGGCGGACGAATTGCGAGCTGCCGAGCGCGCCGTACAGCGCGCTGAGCTC
TTCGACATGAAGTGGGTTGAGGTGCCCTCAGATGTACTGGTGTCGGGCGGGGCATCGGTG
GTGGTGCTGGATGGTGCCGACGACCTCGTTGGTCTGGCGGCTGAGGAGGATGGTGTGCCG
GGGGTGGTGGTGTTGCGGTGCCCGGATGCCGGTGCCGATGGCGGCGGTGGTGGCGGTGGT
GTGGGTGAGGTTGTTGGTGGGGTGTTGGGTGTGGTGCAGGGGTGGCTGGGGCTGGAGCGG
TTTGCGGGTTCGCGGCTGGTGGTGGTGACCCGGGGTGCGGTGGTGGCCGGCCCGGAGGAC
GGCCCGGTGGATGGCCCGGTGGATGTGGTGGGTGCGGCGGTGTGGGGGCTGGTGCGGTCG
GCGCAGGCTGAGCATCCGGACCGGTTTGTCCTCCTCGACCTGGACACCGACCTCGACAGC
GGCGCTGACCGCGATGCCGGCAACGAGGCCGGTATGGGGTCTGGTCTGGATGGTGGGCGT
GTGGCTGCGGTGGTGGCGTGTGGTGAGCCGCAGTTGGCGGTGCGTGGTGAGCGGGTGCTG
GCCGCACGCCTGACACGACTTGAGTCGCCGGTTGATGTATCGGGTCGGGAGGTGTTGCCG
TGGTTGTCGGGTGGGTCGGTGTTGGTGACGGGTGGGACGGGTGTGCTGGGTGCGGCGGTG
GCGCGGCATCTGGCTGGTGTGTGTGGGGTGCGGGATCTGTTGTTGGTGAGCCGGCGTGGT
CCGGATGCTCCGGGTGCGGAGGGTTTGCGGGCGGAGCTGGCCGCGTTGGGGGCGGAGGTG
CGGATTGTTGCGTGTGATGTGGGGGAGCGGCGGGAGGTGGTCCGGCTGCTGGAGGGTGTT
CCTGCCGGGTGTCCGCTGACGGGTGTCGTGCATGCGGCTGGTGTGCTGGACGATGCGACG
ATCGCCTCTCTCACGCCCGAGCGGCTGGGCACGGTGTTCGCGGCCAAGGTGGATGCCGCT
CTTTTGCTGGATGAGCTGACGCGGGGTATGGAGCTGTCGGCGTTCGTGCTGTTCTCCTCG
GCCGCGGGGATCCTGGGGTCGGCCGGGCAGGGCAACTACGCCGCGGCCAATGCCGCTCTG
GACGCGCTGGCGTACCGGCGGCGGGCGGCGGGTCTGCCGGGGGTGTCGCTGGCGTGGGGG
CTGTGGGAAGAGGCCAGCGGGATGACCGGGCATCTGGCCGGCACCGACCACCGGCGCATC
ATCCGTTCCGGTCTGCATCCCATGTCGACCCCGGACGCACTGGCCCTCTTCGATGCGGCC
CTGGCTCTGGACCGGCCGGTCCTGCTGCCCGCCGACCTGCGTCCCGCCCCGCCCCTGCCG
CCCCTGCTGCAGGACCTCCTGCCCGCCACCCGCCGCCGCACCACCCGCACCACCACTACC
GGTGGTGCGGACAACGGCGCCCAGCTGCACGGCCGGCTGGCCGGCCAGACACACGAACAA
CAGCACACCACCCTCCTCGCCCTGGTCCGCTCCCACATCGCCACCGTCCTGGGCCACACC
ACCCCCGACACCATCCCCCCCGACCGCGCGTTCCGCGACCTCGGCTTCGACTCCCTCACC
GCCGTCGAACTACGCAACCGGCTCTCCCACACCACCGGACTCCGCCTCCCCACCACCCTC
GCCTTCGACCACCCCAACCCCACCACCCTCACCCACCACCTCCACACACAACTCGTCAGC
AAGGGACTCACCGCCGCGGCCGAGCCGGACGCCGCAACGACACCCCCGGGGCTGCCCTCG
CTGCTCTCGGAGCTCGAGCGGCTGGAGGCGGTAGTGCTCTCCTCCACCACATCCTCCGCT
GCCCCGCTGGACGACGGCGCGCGCACGCGGCTGGCCTCCCGACTGCATTCCCTCGCCCAG
AAGTTGAACGGCGACGACACCGCCCCCGACCTCGCAGAGACATCGGACGAGGAGATGTTC
GCTCTCATCGACAGGGAAGTCGGATTCGAATCTCAATGA
[7] KS38..413
[7] AT603..921
[7] methylmalonyl-CoA not conserved YASHS(S->C)795..799
[7] dh976..1148
[7] KR1488..1668
[7] ACP1768..1838
[8] KS1863..2241
[8] AT2425..2743
[8] malonyl-CoA2625..2629
[8] DH2797..2969
[8] KR3288..3468
[8] ACP3568..3638
[9] KS3662..4039
[9] AT4211..4531
[9] methylmalonyl-CoA not conserved YASHS(S->C)4403..4407
[9] DH4585..4753
[9] KR5085..5265
[9] ACP5365..5435
[7] KS112..1239
[7] AT1807..2763
[7] methylmalonyl-CoA not conserved YASHS(S->C)2383..2397
[7] dh2926..3444
[7] KR4462..5004
[7] ACP5302..5514
[8] KS5587..6723
[8] AT7273..8229
[8] malonyl-CoA7873..7887
[8] DH8389..8907
[8] KR9862..10404
[8] ACP10702..10914
[9] KS10984..12117
[9] AT12631..13593
[9] methylmalonyl-CoA not conserved YASHS(S->C)13207..13221
[9] DH13753..14259
[9] KR15253..15795
[9] ACP16093..16305

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [599-726]  G3DSA:3.40.366.10 [795-912]  G3DSA:3.40.366.10 [2419-2558]  G3DSA:3.40.366.10 [2625-2732]  G3DSA:3.40.366.10 [4203-4334]  G3DSA:3.40.366.10 [4403-4521]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [3288-3455]  2.70000000000002e-57 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1796-1811]  PS00012 [3596-3611]  PS00012 [5393-5408]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1766-1841]  5.69999999999998e-70 G3DSA:1.10.1200.10 [3566-3641]  5.69999999999998e-70 G3DSA:1.10.1200.10 [5363-5438]  5.69999999999998e-70 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1761-1880]  1.79999754022375e-28 SSF47336 [3561-3679]  4.80000830876748e-29 SSF47336 [5356-5442]  2.39999798157265e-22 SSF47336
SSF47336   ACP_like
 [1772-1837]  2.9e-12 PF00550 [3572-3637]  1.9e-13 PF00550 [5369-5434]  6.60000000000002e-12 PF00550
PF00550   PP-binding
 [1768-1838]  PS50075 [3568-3638]  PS50075 [5365-5435]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1488-1667]  1.6e-57 PF08659 [5085-5264]  1.6e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [38-288]  3.10000000000005e-96 PF00109 [1863-2115]  1.10000000000001e-98 PF00109 [3662-3913]  1e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [296-413]  6.90000000000001e-47 PF02801 [2123-2241]  8.50000000000004e-48 PF02801 [3921-4039]  3.7e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [603-921]  4.40000000000003e-111 PF00698 [2425-2743]  9.29999999999998e-50 PF00698 [4211-4531]  3.10000000000005e-100 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [601-906]  3.699978135861e-68 SSF52151 [2422-2731]  1.3000049540733e-57 SSF52151 [4209-4513]  6.40004254961849e-66 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [728-794]  7.10001443313147e-19 SSF55048 [2559-2624]  1e-12 SSF55048 [4336-4402]  1.59999889349252e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-298]  G3DSA:3.40.47.10 [300-466]  G3DSA:3.40.47.10 [1866-2127]  G3DSA:3.40.47.10 [2128-2294]  G3DSA:3.40.47.10 [3662-3924]  G3DSA:3.40.47.10 [3925-4093]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [30-411]  6.40004254961849e-100 SSF53901 [1856-2239]  1.50000965748778e-105 SSF53901 [3655-4037]  5.6999970878395e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1485-1698]  4.89999999999996e-104 G3DSA:3.40.50.720 [3285-3498]  4.89999999999996e-104 G3DSA:3.40.50.720 [5082-5295]  4.89999999999996e-104 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [201-217]  PS00606 [2028-2044]  PS00606 [3826-3842]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [605-903]  1.19999063421924e-125 SM00827 [2426-2784]  1.19999063421924e-100 SM00827 [4213-4512]  2.50000909916183e-116 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1769-1841]  6.99997659850661e-36 SM00823 [3569-3641]  6.39998633403535e-33 SM00823 [5366-5438]  6.70002630158883e-35 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [976-1148]  8.79996401030984e-66 SM00826 [2797-2969]  1.3000049540733e-81 SM00826 [4585-4753]  5.29997329885557e-65 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [40-467]  SM00825 [1866-2294]  SM00825 [3665-4093]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1488-1668]  1.99999636034521e-57 SM00822 [3288-3468]  1.99999636034521e-57 SM00822 [5085-5265]  1.99999636034521e-57 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit