close all open/close all

CDS information : Aver_00090


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction70,855 / 56,210 / - [in whole cluster]
64,857 / 50,212 / - [in contig]
Locationcomplement(56210..70855) [in whole cluster]
complement(50212..64857) [in contig]
TypeCDS
Length14,646 bp (4,881 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase AVES 4
Gene
Gene (GenBank)aveA4
EC number
Keyword
Note
Note (GenBank)
  • contains Ave module 10, module 11 and module 12; multifunctional polyketide synthase
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[11780788] Organization of biosynthetic gene cluster for avermectin in Streptomyces avermitilis: analysis of enzymatic domains in four polyketide synthases. (J Ind Microbiol Biotechnol. , 2001)

close this sectionPKS/NRPS Module

10 malonyl-CoA
11 methylmalonyl-CoA
not conserved YASHS(Y->W)
12 malonyl-CoA
KS34..409
AT578..899
kr1212..1392
ACP1495..1565
KS1590..1967
AT2139..2457
ACP2537..2607
KS2635..3012
AT3263..3599
DH3650..3827
KR4183..4363
ACP4473..4554
TE4670..4873

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase AVES 4]
MANEEKLRDYLKRVTADLLNVRRRLQQIESGEQEPIAIVGMACRFPGGVESAEDFWELIA
SGRDAVGEFPVDRGWDVEAFYDPEPGRAGSSYTRRGGFLEGAAEFDAGFFGISPREALAM
DPQQRLMLEVSWEALERAGIDPATLRGSRTGVFAGLMSQDYATRLLSVPDDLAGYLGNGN
AGSILSGRVAYTFGFEGPAVTVDTACSSSLVALHLACQSLRTGESSFALAGGVTVMSTPG
MFVEFSRQRGLSPDGRCKAYASAADGTGMSEGVGILLLERLSEAERRGHRVLAVVRGSAV
NQDGASNGLTAPNGPSQQRVIRQALACAGLSVADVDVVEGHGTGTTLGDPIEAQALLATY
GQRAGDTPVWLGSVKSNIGHAQAAAGVAGVIKMVMALRAGVLPRTLHVDEPSSQVDWSSG
SVRVLADEVEWPGVEGRLRRAGVSAFGVSGTNAHVILEEASGGAGGGAGRLQELGPGVVS
GSGVVPWVVSARSELALRGQARRLRGVVAVGGGADGVGVSPAGVGRALVSERSVFEHRAV
VVAEDRDEFLHALDALAGGRPVPGVVEGRTTSGELAVLFAGQGTQRAGMGRELYEAYPVF
AQAIDEICAEADTARTDPGAPGLRDVLFAPQDSPEGRLIEDTGFAQPALFAFEVALFRLL
ETWGLTPDYVLGHSVGELAAAHVAGMLCLADAVALVVARGRLMQGLPSGGAMVAIEASED
EILPLPDEYASRVAHAAVNGPRSIVLSGDEDAVLDLAQQWAARGRRTRRLRTSHAFHSPH
MDAMLGDFRRAAEQVTFSAPRIPVVSNVTGAPLPAETMCTPDYWVEHARSTVRFADGISW
LQEQGVTTCLEIGPDGTLSALAQDSLSAPARAIPALRPDQPEARSVMTALAELFVAGTAV
EWAGVFEGTAREVGDGCGVELPTYAFERERFWLDVEEGSAGGSGVSGMWGGPLWEAVECG
DAGVVASLLGVDEGASLGAVVSALGEWGRVRHEREVVDGWRYREVWRPVSGGGVGGLSGA
WLVVSEGEAGPVDVVAEGLERCGARVVRVEVEAGCVSREVLAGHLREAVDGEAVGGVVSL
VGWGSGVVQAGVASVGLVQALGDVGVGARLWCVTGGAVSVGGRDAVWGPASGVVWGLGRV
VGAEAPDRWGGLVDVPELVDERVVDGLVGVLAGVGGGGESEFAVRSSGAFVRRLVRAPLE
EAVAEREWRPRGTVLVTGGTGELGAHVARWMARRGAEHLLLVSRRGESAQGVEELRADLM
GLGARVSVVACDAADREALAEVLRSAVPAECPLGVVVHAAGVVDDGVLEGLSSERVTGVL
RAKALAAWNLHELTRGADLSGFVVFSSAAATFGPAGQGSYAAANAYVEAIVRHRRGEGLP
GLAVAWGPWAGGGMAEGAVGQMRRRGLAAMTPETALVALGQALDHDETCVTVADIDWDRF
TANSLPGSRLSPLISDIPEARLARETTGLDTATASPDSFSARLKAMDTAEQERALLDLVR
TYAATVLGHSTPTAVRPERAFRDLGFVSVSAVELRNRLNAVTGLLLPTTLIFDYPTPSAL
AGYLKEQLEEGAGGQRDIAPPVPASRVDVDEPIAIVGMACRFPGGVESAEDLWELVASGR
DAVGEFPVDRGWDVEAFYDPEPGRAGSSYTRRGGFLEGAAEFDAGFFGISPREALAMDPQ
QRLMLEVSWEALERAGIDPATLRGSTTGVFAGMCSQDYADLVRRATEDLEGYAMTGLSSS
VTSGRVAYTLGLEGPAVTVDTACSSSLVALHLACQALRSGECSLALAGGVTVMSTPGAFV
EFSRQRGLSPDGRCKAYGSGADGVGWAEGVGVLLVERLSEAERRGHRVLAVVRGSAVNQD
GASNGLTAPNGPSQQRVIRQALACAGLSVADVDVVEGHGTGTTLGDPIEAQALLATYGQG
RSGERPVWLGSVKSNIGHAQAAAGVAGVIKMVMALRAGVLPRTLHVDEPSSQVDWSSGSV
RVLADEVEWPGVEGRLRRAGVSAFGVSGTNAHVILEEASGGADGGAGRLQELGPGVVSGS
GVVPWVVSARSELALRGQARRLRGVVAVGGGADGVGVSPAGVGRALVSERSVFEHRAVVV
AEDRDEFLHALDALAEGAPTAGVVQGVAGPAADGKIAMLFGGQGTHWEGMAQELLGSSPV
FAQQMSDCAQALEPYLDWSLLDVLRGAPDAPPLQRVDVVQPVLFAVMVSLAALWRSYGVH
PDAVAGHSQGEIAAAYVAGALSLDDAARVTALRSQALAALAGQGAMASVGLPVEKLEPRL
ATWGDRLVIAAVNGARSAVVSGEPEAVDALVEELSHEDVPARRLMVDWASHSPQVEAIQG
RLLELLAPIRARTGDVPFYSTVTGERIDGTELDADYWYRNLRQVVRFRDATQALVRAGHT
VFIEACPHPAVAVGVQETLDEMGDLDSLVVGSLRRGEGGLRRFLMSVAELFVGGVAVEWS
GVFGSVGRGVAGGCGVELPTYAFERERFWLDVEGAPRGSGVSGQWGGQLSEAVDTVRGGM
LRDCLAGLDPAAQAETVLDLVLTHAAAVLGHGTADAVVPERAFRDLGFDSLTAVELRNRL
NTATGLRFPRTLVFDHPRPVALAAHIHEQLSGGSPTTGTALALALRAPAPRVDVDEPIAI
VGMACRFPGGVESAEDFWELIASGRDAVGEFPVDRGWDVEAFYDPEPGRAGTSYTRCGGF
LQGAAEFDAGFFGISPREALAMDPQQRLMLEVSWEALERAGIDPATLHGSTTGVFAGVSQ
QDYAELLRRGTQDHEGYALTGVSNSVVSGRLSYTFGFEGPAVTVDTACSSSLVALHLACQ
ALRSGECSLALAGGVTVMSTPGAFVEFSRQRGLSPDGRCKAYGSGADGVGWAEGVGVLLV
ERLSEAERRGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALACAGLSVADVDVV
EGHGTGTTLGDPIEAQALLATYGQGRSGERPVWLGSVKSNIGHAQAAAGVAGVIKMVMAL
NHELLPTSLHIDEPSPHIDWSSGGVRLLTEPVPWQQNGRPRRAGVSAFGVSGTNAHVIIE
QAPVEAHVISEPVPAEAHVIVEQAPVEAPHVVDATGPADLTEPQEEAAEPECVADAVTEM
SAEPECVADAMSEMSAECVAEAVSDKSAEPECVADAMSDKPALLPIPWLLSAKSERALRG
QARRLRQFAARASDARPADVAHALAAQRSVFDHRAVVVAEDRDGFLQALDALAEGRSADG
LIEGSVGPRGGHSGRRRGKTAMLFAGQGTQRVGMGRQLYAAHPAYADALDQVLAELDGHL
DQPLRPLIHASADLADVADAADVLDRTRYAQPALFAVQVALFRHLERLGVRADFVAGHSI
GELAAAHVAGVLPLAAACRLVAARGRLMEQLAPGGAMVAVRASEAEARQALDGREARVSV
AAVNGPASVVFSGAEDEVGNMADWFAERGRRVKRLRTGHAFHSPLMDPMLEEFQQVAASL
TYSEPAIPMVSTLTGDIVAAGELSDPEYWVRQVRRTVRFGDAISRLHTDGVRTFMELGPD
GTLSALAEECLEATADSHPADDDTGTPQENLLIPLLRPDSPEPGTLLTGLARLHTHGAAA
VNWPAALPERDRARHLDLPTYAFDHHRYWVDTSAGHPGDLSAAGLGTAGHPLLGSAVALA
ESQELLFTGRLSLRTHPWLADHAIFGTVLLPGTAILELAVRAGDEVDCGTVEELTLRTPL
VLPEQGSVILQLSVGAPQGPQTPEEPERRTFALYAREDDGLSSSSAAATGTEWTCHATGV
LTGTARPAEEHTQEPWPPADAAPVDLDGWYEQLAGAGLGYGPVFQGLREVWRRGDEVFAV
VTLPESTEGQAADAARYALHPALLDAALHPVVLRHEGDAAADGHGWLPFSWTGVTVAASG
ASTLHVRLTVRTDEDAVGLLATDASGRIVISAGSLAFRPVSAEQLQAARTGYHDHLFRIE
WRPLHLPTTPARTADWALIGPGARRTAAVLERNGASWQAYPDPAALAEALAAGAPAPGMV
VISCEPDGASAPTDSALTDSALTDSAPAGSAPADSTALADATRQATTRVLALLQEWVADE
RLAACRLALLTHGSVTATPDEPVSDLAHAAVWGLVRSVQTENPDRFLLADTDDTDASRNA
LPLLAGEPQIALRNGAVRIPRMTRVPVRQPQPSTTDADWDPEATVLITGGTGVLGRLVAR
HLATAHGVRHLLLATRRGTAADGAADLVAELAGLGAEATVAACDIGDRAAVAALLDQVPA
QHPLKAVIHTAGVVDDGILTSLTPERMEAVLHAKAFGAAHLHDLTRDAGLTTFTVFSSAA
ASFGSPGQGNYTAANAFLDALMQHRHTQALPGRSLAWGLWGEADGMTRNLAGTDFARMAR
GGLLPLSNAQGLALLDTADRLGPFGDGLLLATRLDAATLHAQATAGALPRILHGLIRIPA
RRSADHGIATDTPATLRERLAGLTIPAQRTGLLLELVRTHAAAVLGHPTSAVTAADGALP
DDLVPADTEFRDLGFDSLTAVELRNRINAVTGLRLPATLIFDQPSPAALADHLATRLTAE
AGTPDEPAPAAAAAGAGSAGSAETGQQRSTGSEKQQTRGGTSTETVESLFWIGHDTRRIE
ESMALLSAASFFRPAFTDPSDIPEPTFVRLAQGEARAQGEALARGETRPALICLPTVAAV
SSVYQYSRFAAGLNGHRDVWYVPAPGFLEGEPLPSGIGAVTRMFADAIVRFTDGAPFALA
GHSAGGWFVYAVTSHLERLGVRPEAVVTMDAYLPDDGIAPVASALTSEIFDRVTQFVDVD
YTRLVAMGGYFRIFSGWSPPDITTPALFLRGRDGEQMPPPWGVPHTVLDIQGNHFTMLEQ
FADSTARHVDEWLTEIASVRR
selected fasta
>polyketide synthase [type I polyketide synthase AVES 4]
ATGGCTAACGAGGAAAAGCTCCGCGACTATCTCAAGCGCGTTACTGCCGATCTCCTCAAT
GTGCGGCGTCGACTTCAGCAGATTGAATCGGGCGAGCAGGAGCCGATTGCAATTGTGGGG
ATGGCGTGCCGTTTTCCGGGGGGTGTGGAGTCGGCGGAGGATTTCTGGGAGTTGATTGCG
TCGGGTCGGGATGCGGTGGGGGAGTTTCCGGTCGACCGGGGTTGGGACGTGGAGGCTTTC
TATGATCCGGAGCCGGGGCGGGCGGGTTCGTCGTATACGCGCCGGGGCGGTTTCCTGGAG
GGTGCGGCGGAGTTCGATGCGGGGTTTTTCGGGATCAGTCCGCGTGAGGCGTTGGCGATG
GATCCGCAGCAGCGGTTGATGCTGGAGGTGTCCTGGGAGGCGTTGGAGCGGGCGGGCATC
GACCCCGCCACGTTGCGCGGCAGCCGGACGGGCGTCTTCGCCGGCCTCATGTCCCAGGAC
TACGCGACCCGTCTGCTCTCGGTCCCCGACGACCTGGCCGGCTACCTGGGCAACGGCAAC
GCGGGAAGCATCCTGTCCGGACGCGTCGCCTACACCTTCGGCTTCGAGGGCCCCGCGGTG
ACGGTCGACACGGCGTGCTCGTCGTCGCTGGTGGCACTGCACCTCGCCTGCCAGTCACTG
CGCACCGGTGAGTCCTCCTTCGCCCTCGCCGGAGGCGTGACGGTCATGTCCACCCCGGGC
ATGTTCGTGGAGTTCTCGCGGCAGCGGGGTCTGTCGCCGGACGGCCGGTGCAAGGCGTAC
GCGTCGGCTGCCGACGGCACCGGCATGTCCGAGGGCGTGGGGATTTTGCTGCTGGAGCGG
CTGTCCGAGGCTGAACGTCGTGGTCATCGGGTTTTGGCGGTGGTGCGGGGGAGTGCGGTG
AATCAGGACGGTGCGTCGAATGGGTTGACGGCGCCGAATGGTCCGTCGCAGCAGCGGGTG
ATTCGGCAGGCGTTGGCGTGTGCGGGGTTGTCTGTGGCGGATGTGGATGTGGTGGAGGGG
CACGGGACGGGCACGACGCTGGGTGATCCGATCGAGGCGCAGGCGTTGCTCGCCACGTAC
GGGCAGCGGGCCGGTGACACGCCGGTGTGGTTGGGGTCGGTGAAGTCGAACATCGGGCAT
GCGCAGGCTGCTGCGGGTGTGGCGGGTGTGATCAAGATGGTGATGGCGTTGCGGGCGGGG
GTGTTGCCGCGGACGTTGCATGTGGATGAGCCGTCGTCGCAGGTGGATTGGTCGAGTGGG
TCGGTTCGTGTGTTGGCGGATGAGGTGGAGTGGCCGGGGGTGGAGGGTCGGCTGCGGCGT
GCGGGGGTGTCTGCGTTCGGGGTGAGTGGGACGAATGCGCATGTGATTTTGGAGGAGGCG
TCGGGGGGCGCGGGTGGGGGTGCGGGCCGGCTGCAGGAGTTGGGTCCGGGGGTGGTGTCG
GGTTCGGGGGTGGTGCCGTGGGTGGTGTCGGCGCGGTCGGAGTTGGCGTTGCGGGGGCAG
GCGCGTCGGTTGCGTGGGGTTGTGGCGGTTGGTGGGGGTGCGGATGGTGTGGGGGTGAGT
CCGGCTGGGGTCGGGCGGGCTTTGGTGTCGGAGCGGTCGGTGTTCGAGCATCGTGCGGTG
GTCGTGGCCGAGGACCGCGACGAGTTCCTGCACGCACTCGACGCACTGGCCGGCGGCCGC
CCCGTGCCCGGCGTCGTCGAGGGACGAACCACCTCGGGCGAACTCGCCGTACTCTTCGCC
GGGCAGGGAACCCAGCGCGCAGGCATGGGCCGCGAACTGTACGAGGCGTACCCCGTCTTC
GCCCAGGCCATCGACGAGATCTGCGCGGAGGCCGACACCGCCCGCACCGACCCCGGTGCC
CCTGGGCTGCGGGACGTACTCTTCGCACCGCAGGACTCTCCCGAAGGCCGGCTGATCGAG
GACACGGGTTTCGCCCAGCCCGCCCTGTTCGCCTTCGAGGTGGCGCTGTTCCGGCTGCTG
GAGACCTGGGGTCTGACGCCCGACTACGTCCTCGGCCATTCCGTCGGTGAACTGGCGGCC
GCCCATGTCGCCGGGATGCTCTGCCTTGCCGACGCGGTGGCACTGGTGGTCGCACGAGGC
CGCCTGATGCAAGGGCTCCCGTCCGGCGGAGCCATGGTGGCCATCGAGGCGTCCGAGGAC
GAGATCCTCCCGCTGCCCGACGAATACGCATCCCGGGTCGCGCACGCCGCGGTGAACGGG
CCGCGGTCGATCGTCCTCTCCGGGGACGAGGACGCGGTCCTGGACCTCGCGCAGCAATGG
GCGGCACGAGGCCGCCGCACCCGGCGGCTGCGGACCAGCCACGCCTTCCACTCGCCGCAC
ATGGACGCCATGTTGGGCGACTTCCGCCGCGCGGCCGAGCAGGTCACCTTCAGCGCCCCG
CGGATTCCCGTCGTCTCCAACGTCACCGGCGCGCCCCTCCCCGCCGAGACCATGTGCACC
CCGGACTACTGGGTCGAACACGCCCGCAGCACGGTCCGTTTCGCGGACGGCATCTCATGG
CTTCAGGAACAGGGCGTCACCACCTGCCTCGAAATCGGCCCCGACGGCACGCTGTCGGCC
CTCGCACAGGACTCGCTCAGTGCACCGGCCCGCGCCATCCCCGCCCTGCGGCCGGACCAG
CCGGAGGCACGGTCGGTCATGACCGCCCTGGCGGAGTTGTTCGTGGCTGGGACGGCGGTT
GAGTGGGCCGGTGTGTTCGAGGGGACTGCTCGCGAGGTCGGTGATGGATGCGGGGTGGAG
CTGCCGACGTATGCGTTTGAGCGGGAGCGATTTTGGCTGGACGTGGAGGAGGGATCTGCG
GGAGGTTCCGGGGTTTCCGGGATGTGGGGTGGTCCGTTGTGGGAGGCGGTCGAGTGTGGT
GATGCGGGGGTGGTGGCATCGCTCCTTGGGGTGGATGAGGGGGCGTCGCTGGGTGCGGTG
GTGTCGGCGTTGGGGGAATGGGGGCGGGTACGGCACGAGCGTGAAGTGGTGGACGGGTGG
CGCTATCGGGAGGTGTGGCGACCCGTTTCGGGCGGTGGTGTAGGGGGGCTGTCGGGCGCG
TGGCTGGTGGTGTCCGAGGGCGAGGCGGGCCCGGTTGATGTGGTGGCGGAGGGGTTGGAG
CGGTGTGGGGCGCGAGTGGTTCGGGTGGAGGTGGAAGCGGGGTGTGTGAGCAGGGAAGTG
TTGGCCGGCCACCTGCGTGAGGCGGTCGATGGTGAGGCTGTCGGCGGTGTCGTCTCCCTT
GTGGGCTGGGGGAGTGGCGTCGTGCAGGCGGGAGTGGCGTCTGTGGGGTTGGTGCAGGCG
CTGGGTGATGTGGGCGTGGGGGCGCGGCTGTGGTGTGTGACGGGCGGGGCCGTGTCGGTG
GGGGGCCGGGATGCTGTGTGGGGGCCGGCCTCGGGTGTGGTGTGGGGGCTGGGCCGTGTG
GTGGGGGCGGAGGCACCGGACCGCTGGGGTGGGCTGGTTGATGTGCCGGAGCTCGTGGAT
GAGCGGGTGGTCGATGGGTTGGTAGGTGTGCTGGCGGGTGTGGGGGGAGGGGGTGAGAGT
GAGTTTGCCGTGCGGTCTTCGGGGGCGTTTGTGCGGCGGTTGGTGCGGGCGCCGTTGGAG
GAGGCCGTCGCGGAGCGGGAGTGGCGGCCCCGCGGCACCGTACTCGTCACCGGAGGCACC
GGCGAGTTGGGTGCGCACGTCGCCCGGTGGATGGCCCGGCGTGGCGCCGAACACCTGCTG
CTGGTGAGCCGACGCGGGGAGAGCGCCCAGGGAGTCGAAGAACTCCGAGCGGACTTGATG
GGCTTGGGCGCGCGGGTGTCGGTGGTGGCGTGTGATGCGGCGGACCGTGAGGCGTTGGCG
GAGGTGTTGCGGTCGGCCGTTCCGGCGGAGTGCCCGCTGGGTGTGGTGGTGCATGCCGCG
GGAGTTGTGGATGACGGGGTGTTGGAGGGGTTGTCGTCCGAGCGTGTCACGGGGGTGCTG
CGGGCGAAGGCGCTGGCGGCCTGGAATCTGCATGAGTTGACGCGGGGGGCGGATCTTTCG
GGGTTCGTGGTGTTCTCGTCGGCTGCGGCGACGTTCGGGCCGGCGGGACAGGGGAGTTAC
GCGGCGGCGAACGCGTATGTGGAGGCAATCGTTCGGCACCGGCGTGGTGAGGGCCTGCCG
GGGTTGGCGGTGGCGTGGGGTCCGTGGGCTGGTGGGGGGATGGCGGAGGGGGCCGTGGGG
CAGATGCGGCGTCGGGGTCTGGCGGCGATGACGCCGGAGACGGCGCTGGTGGCACTGGGC
CAGGCGTTGGACCATGACGAGACCTGTGTGACGGTCGCCGACATCGACTGGGACCGATTC
ACCGCCAACTCCCTCCCCGGCTCCCGACTCTCGCCCCTCATCAGCGACATCCCCGAAGCA
CGCCTCGCCCGGGAAACCACCGGACTCGACACCGCCACCGCATCCCCCGACTCGTTCTCC
GCACGGCTCAAGGCCATGGACACCGCCGAGCAGGAACGTGCGCTTCTCGACCTGGTCCGT
ACGTACGCGGCGACCGTGCTCGGACACAGCACCCCCACCGCCGTACGCCCTGAGCGAGCC
TTCCGCGACCTGGGCTTCGTCTCCGTGAGCGCCGTCGAACTGCGCAACCGCCTCAACGCC
GTCACCGGGCTCCTCCTGCCCACCACGCTGATCTTCGACTACCCCACTCCCTCCGCGCTG
GCCGGATACCTCAAGGAACAGCTGGAGGAGGGCGCGGGCGGCCAGCGTGACATTGCTCCT
CCGGTCCCGGCGTCGCGTGTCGACGTTGACGAGCCGATTGCGATTGTGGGGATGGCGTGC
CGTTTTCCGGGGGGTGTGGAGTCGGCGGAGGACTTGTGGGAACTGGTCGCGTCGGGTCGG
GATGCGGTGGGAGAGTTTCCGGTCGACCGGGGTTGGGACGTGGAGGCTTTCTATGATCCG
GAGCCGGGGCGGGCGGGTTCGTCGTATACGCGCCGGGGCGGTTTCCTGGAGGGTGCGGCG
GAGTTCGATGCGGGGTTTTTCGGGATCAGTCCGCGTGAGGCGTTGGCGATGGATCCGCAG
CAGCGGTTGATGCTGGAGGTGTCCTGGGAGGCGTTGGAGCGGGCGGGCATCGACCCCGCC
ACGTTGCGCGGGTCCACGACCGGTGTCTTCGCCGGCATGTGCAGTCAGGACTACGCCGAC
CTCGTGCGCCGGGCCACCGAGGACCTCGAGGGCTACGCCATGACGGGCCTGTCCAGCAGC
GTCACATCCGGACGCGTCGCCTACACCCTGGGGCTCGAGGGTCCGGCGGTGACGGTGGAT
ACGGCGTGTTCGTCGTCGTTGGTGGCGCTGCATCTGGCGTGTCAGGCGTTGAGGTCGGGG
GAGTGTTCGCTGGCGTTGGCGGGGGGTGTGACGGTGATGTCGACGCCGGGTGCGTTTGTG
GAGTTCTCGCGGCAGCGGGGTCTGTCGCCGGACGGCCGGTGCAAGGCGTACGGGTCGGGG
GCCGATGGGGTCGGCTGGGCCGAGGGTGTGGGTGTGCTGTTGGTGGAGCGGCTGTCCGAG
GCTGAACGTCGTGGTCATCGGGTTTTGGCGGTGGTGCGGGGGAGTGCGGTGAATCAGGAC
GGTGCGTCGAATGGGTTGACGGCGCCGAATGGTCCGTCGCAGCAGCGGGTGATTCGGCAG
GCGTTGGCGTGTGCGGGGTTGTCCGTGGCGGATGTGGATGTGGTGGAGGGGCACGGGACG
GGTACGACGTTGGGTGATCCGATCGAGGCGCAGGCGTTGCTCGCCACTTATGGGCAGGGT
CGTTCGGGGGAGCGGCCGGTGTGGTTGGGGTCGGTGAAGTCGAACATCGGGCATGCGCAG
GCTGCTGCGGGTGTGGCGGGTGTGATCAAGATGGTGATGGCGTTGCGGGCGGGGGTGTTG
CCGCGGACGTTGCATGTGGATGAGCCGTCGTCGCAGGTGGATTGGTCGAGTGGGTCGGTT
CGTGTGTTGGCGGATGAGGTGGAGTGGCCGGGGGTGGAGGGTCGGCTGCGGCGTGCGGGG
GTGTCTGCGTTCGGGGTGAGTGGGACGAATGCGCATGTGATTTTGGAGGAGGCGTCCGGG
GGCGCGGATGGGGGTGCGGGCCGGCTGCAGGAGTTGGGTCCGGGGGTGGTGTCGGGTTCG
GGGGTGGTGCCGTGGGTGGTGTCGGCGCGGTCGGAGTTGGCGTTGCGGGGGCAGGCGCGT
CGGTTGCGTGGGGTTGTGGCGGTTGGTGGGGGTGCGGATGGTGTGGGGGTGAGTCCGGCT
GGGGTCGGGCGGGCTTTGGTGTCGGAGCGGTCGGTGTTCGAGCATCGTGCGGTGGTCGTG
GCCGAGGACCGCGACGAGTTCCTGCACGCACTCGACGCACTGGCCGAGGGGGCACCCACC
GCGGGGGTGGTACAGGGTGTGGCCGGACCGGCGGCCGACGGAAAGATCGCCATGCTGTTC
GGAGGACAGGGCACCCACTGGGAAGGCATGGCGCAGGAACTCCTCGGCTCCTCACCGGTC
TTCGCCCAGCAGATGTCCGACTGCGCCCAAGCCCTCGAACCGTACCTGGACTGGTCTCTC
CTCGACGTCCTGCGCGGCGCACCGGACGCACCCCCTCTGCAACGCGTCGATGTCGTCCAG
CCCGTCCTCTTCGCGGTGATGGTCTCGCTGGCGGCGCTCTGGCGCTCGTACGGTGTACAC
CCGGACGCGGTGGCCGGGCACTCGCAGGGCGAGATCGCAGCGGCCTACGTCGCCGGTGCA
CTCTCCCTCGACGACGCCGCCCGGGTCACCGCCCTGCGCAGCCAGGCGCTGGCCGCACTG
GCCGGGCAGGGGGCGATGGCATCGGTCGGTCTGCCGGTCGAGAAGCTGGAGCCGCGTCTT
GCGACATGGGGCGACCGTCTGGTCATCGCCGCCGTGAACGGGGCGCGTTCGGCCGTGGTC
TCCGGGGAGCCGGAAGCGGTCGACGCCCTGGTGGAGGAGCTGTCACACGAAGACGTACCG
GCCCGCAGGCTCATGGTCGACTGGGCGTCGCACTCCCCGCAGGTCGAGGCGATCCAGGGG
CGGCTGCTCGAACTCCTCGCCCCCATCCGCGCGAGGACCGGCGACGTGCCCTTCTACTCC
ACCGTCACCGGCGAACGCATCGACGGCACCGAACTCGACGCCGACTACTGGTACCGCAAC
CTGCGCCAGGTCGTCCGCTTCCGGGACGCGACACAGGCGCTGGTCCGCGCCGGCCACACC
GTCTTCATCGAGGCGTGCCCGCATCCGGCCGTCGCGGTCGGTGTGCAGGAAACCCTGGAC
GAGATGGGTGACTTGGACAGCCTGGTCGTCGGATCTCTGCGCCGGGGCGAAGGCGGCTTG
CGACGCTTCCTGATGTCCGTGGCCGAGTTGTTCGTGGGTGGGGTGGCGGTTGAGTGGTCC
GGTGTGTTCGGGAGTGTTGGTCGCGGGGTCGCTGGTGGTTGCGGGGTGGAGCTGCCGACG
TATGCGTTCGAGCGAGAGCGCTTTTGGCTGGATGTGGAGGGGGCGCCGCGGGGTTCCGGG
GTCTCTGGGCAGTGGGGTGGTCAGTTGTCGGAGGCGGTGGACACCGTGCGCGGCGGCATG
CTGCGCGACTGCCTCGCCGGACTCGACCCCGCCGCACAGGCCGAGACCGTGCTGGACCTG
GTCCTTACCCATGCCGCGGCCGTCCTTGGACACGGCACCGCCGATGCGGTGGTGCCCGAG
CGCGCCTTCCGCGACCTCGGTTTCGACTCCCTCACCGCCGTCGAACTACGCAACCGCCTC
AACACCGCCACGGGCCTGCGCTTCCCGAGGACCCTGGTGTTCGACCATCCCCGCCCGGTG
GCACTCGCGGCACACATCCACGAGCAGCTGAGCGGCGGAAGCCCGACCACCGGCACTGCC
CTTGCCCTTGCCCTTCGGGCCCCGGCACCGCGTGTGGATGTCGACGAGCCGATTGCCATT
GTGGGGATGGCGTGCCGTTTTCCGGGGGGTGTGGAGTCGGCGGAGGATTTCTGGGAGTTG
ATCGCGTCGGGTCGGGATGCGGTGGGGGAGTTTCCGGTCGACCGGGGTTGGGACGTGGAG
GCTTTCTATGATCCGGAGCCGGGGCGGGCGGGTACGTCCTACACGCGGTGTGGTGGGTTT
TTGCAGGGTGCGGCGGAGTTCGATGCGGGGTTTTTCGGGATCAGTCCGCGTGAGGCGTTG
GCGATGGATCCGCAGCAGCGGTTGATGCTGGAGGTGTCCTGGGAGGCGTTGGAGCGGGCG
GGCATCGACCCCGCCACGCTGCACGGGTCCACGACCGGTGTCTTCGCCGGCGTCTCGCAG
CAGGACTACGCCGAGCTCCTGCGCCGCGGCACCCAGGACCACGAGGGGTACGCGCTCACC
GGCGTCTCCAACAGCGTCGTCTCCGGGCGGCTTTCCTACACCTTCGGCTTCGAGGGTCCG
GCGGTGACGGTGGATACGGCGTGTTCGTCGTCGTTGGTGGCGCTGCATCTGGCGTGTCAG
GCGTTGAGGTCGGGGGAGTGTTCGCTGGCGTTGGCGGGGGGTGTGACGGTGATGTCGACG
CCGGGTGCGTTTGTGGAGTTCTCGCGGCAGCGGGGTCTGTCGCCGGACGGCCGGTGCAAG
GCGTACGGGTCGGGGGCCGATGGGGTCGGCTGGGCCGAGGGTGTGGGTGTGCTGTTGGTG
GAGCGGCTGTCCGAGGCTGAACGTCGTGGTCATCGGGTTTTGGCGGTGGTGCGGGGGAGT
GCGGTGAATCAGGACGGTGCGTCGAATGGGTTGACGGCGCCGAATGGTCCGTCGCAGCAG
CGGGTGATTCGGCAGGCGTTGGCGTGTGCGGGGTTGTCCGTGGCGGATGTGGATGTGGTG
GAGGGGCACGGGACGGGTACGACGTTGGGTGATCCGATCGAGGCGCAGGCGTTGCTCGCC
ACGTACGGGCAGGGTCGTTCGGGGGAGCGGCCGGTGTGGTTGGGGTCGGTGAAGTCGAAC
ATCGGGCATGCGCAGGCTGCCGCGGGTGTGGCCGGTGTGATCAAGATGGTCATGGCCCTG
AACCACGAACTGTTGCCGACCAGCCTGCACATCGACGAACCCTCCCCCCACATCGACTGG
TCGAGCGGCGGCGTCCGGCTTCTCACCGAGCCCGTACCGTGGCAGCAGAACGGCCGGCCC
AGGCGCGCGGGCGTCTCCGCGTTCGGAGTCAGCGGGACCAACGCCCACGTCATCATCGAG
CAGGCGCCGGTCGAGGCGCACGTCATCAGTGAGCCGGTACCGGCTGAGGCGCACGTCATC
GTCGAGCAGGCGCCGGTCGAGGCGCCCCACGTGGTCGACGCCACCGGACCGGCGGACCTC
ACCGAGCCGCAAGAGGAGGCGGCTGAACCGGAGTGCGTCGCTGACGCCGTGACCGAGATG
TCGGCTGAACCGGAGTGCGTCGCCGACGCCATGTCCGAGATGTCGGCTGAGTGCGTCGCC
GAGGCCGTGTCCGACAAGTCGGCTGAACCGGAGTGCGTCGCCGACGCCATGTCCGACAAG
CCGGCCCTCCTGCCCATCCCGTGGCTGCTCTCCGCCAAGTCCGAGCGAGCGCTGCGGGGC
CAGGCGCGACGGTTGCGGCAGTTCGCTGCCAGGGCATCCGATGCCCGGCCGGCCGACGTG
GCGCACGCCCTGGCGGCACAGCGGTCCGTGTTCGATCACCGGGCCGTCGTCGTGGCCGAG
GACCGCGACGGCTTCCTTCAGGCCCTCGACGCGCTGGCCGAGGGCCGGTCGGCGGACGGC
CTGATCGAAGGGTCGGTCGGCCCGCGTGGCGGCCACTCAGGCCGCCGGCGCGGAAAGACC
GCCATGCTGTTCGCCGGACAGGGCACGCAACGCGTGGGAATGGGCCGTCAGCTGTATGCG
GCTCACCCGGCCTACGCGGACGCGCTGGACCAGGTACTGGCGGAACTGGACGGTCACCTG
GACCAGCCCCTGCGCCCGCTGATCCACGCCAGTGCGGATCTTGCGGATGTCGCGGATGCC
GCGGATGTTCTGGACCGTACGCGGTACGCCCAGCCGGCGCTGTTCGCCGTCCAGGTCGCG
CTCTTCCGGCACCTGGAACGTCTCGGCGTGCGCGCGGACTTCGTGGCCGGGCACTCGATC
GGCGAGCTCGCGGCCGCCCACGTCGCCGGGGTGCTTCCCCTGGCAGCAGCCTGCCGCCTG
GTGGCGGCCCGCGGGCGCCTGATGGAGCAGCTCGCACCAGGCGGCGCCATGGTCGCCGTA
CGGGCGAGCGAAGCCGAGGCGCGACAGGCGCTCGACGGCCGGGAAGCCCGGGTGTCGGTC
GCGGCCGTGAACGGACCCGCCTCGGTGGTGTTCTCCGGCGCCGAGGACGAGGTGGGGAAC
ATGGCGGACTGGTTCGCCGAGCGCGGGCGGAGAGTCAAGCGCCTGCGAACCGGGCATGCC
TTCCACTCACCGCTGATGGACCCGATGCTGGAGGAGTTCCAGCAGGTCGCGGCCTCGCTG
ACCTACAGCGAACCAGCCATTCCCATGGTGTCGACGCTCACCGGCGACATCGTGGCGGCG
GGAGAACTGAGCGACCCCGAGTACTGGGTCCGGCAGGTACGGCGGACCGTGCGCTTCGGC
GACGCGATCAGCCGCCTGCACACCGACGGAGTCCGCACCTTCATGGAACTGGGCCCAGAC
GGGACCCTGTCGGCACTGGCCGAGGAATGCCTAGAGGCCACCGCCGACAGCCACCCCGCC
GACGACGACACCGGCACCCCGCAAGAGAACCTGCTCATCCCGCTCCTACGGCCGGACAGC
CCGGAACCCGGCACCCTGCTCACCGGCTTGGCCCGGCTGCATACGCACGGAGCGGCGGCG
GTCAACTGGCCCGCCGCCCTGCCCGAACGCGATCGAGCCCGCCACCTCGACCTGCCGACC
TACGCCTTCGATCACCACCGCTACTGGGTCGACACCTCGGCCGGCCACCCGGGGGACCTG
TCGGCAGCGGGGCTCGGCACCGCCGGGCATCCCCTGCTCGGTTCCGCGGTGGCACTGGCC
GAGTCGCAGGAACTCCTCTTCACCGGCCGTCTCTCCCTGCGCACACACCCGTGGCTGGCC
GACCACGCCATCTTCGGTACCGTCCTGCTGCCCGGCACGGCCATCCTGGAACTGGCCGTG
CGCGCAGGCGACGAGGTCGACTGCGGCACCGTCGAGGAACTCACCCTGCGGACACCGCTC
GTCCTTCCCGAACAGGGCTCGGTGATCCTGCAACTCTCCGTCGGGGCACCCCAGGGCCCC
CAGACGCCCGAGGAGCCCGAACGGCGCACCTTCGCCCTGTACGCCCGCGAAGACGACGGA
CTGTCGTCCTCGTCCGCGGCGGCGACCGGCACCGAGTGGACCTGCCACGCCACCGGCGTC
CTGACCGGCACCGCCCGGCCCGCGGAGGAGCACACACAGGAACCGTGGCCGCCCGCCGAC
GCAGCACCGGTGGACCTGGACGGCTGGTACGAGCAGCTGGCCGGCGCCGGCCTGGGATAC
GGGCCGGTGTTCCAGGGGCTGCGCGAGGTCTGGCGGCGCGGGGACGAGGTGTTCGCCGTC
GTCACCCTGCCCGAGAGCACGGAGGGACAGGCGGCCGACGCCGCCCGGTACGCCCTGCAC
CCGGCCCTGCTGGACGCGGCACTGCACCCGGTCGTTCTGCGCCACGAGGGCGATGCCGCC
GCCGACGGACACGGCTGGCTGCCGTTCTCCTGGACCGGCGTCACGGTCGCCGCCTCCGGC
GCCTCCACCCTGCACGTCCGTCTCACCGTCCGCACGGACGAGGACGCGGTCGGACTGCTG
GCCACCGACGCATCGGGACGCATCGTCATCTCCGCGGGGTCCCTCGCCTTCCGGCCCGTC
TCCGCCGAGCAGCTCCAGGCCGCGCGCACCGGCTACCACGACCACCTCTTCCGCATCGAA
TGGCGGCCGCTGCACCTCCCCACCACACCGGCACGGACAGCCGACTGGGCCCTAATCGGC
CCCGGTGCCCGGCGGACGGCCGCCGTCCTGGAGCGCAACGGCGCCTCCTGGCAGGCCTAC
CCGGACCCGGCGGCTCTCGCAGAAGCCCTGGCGGCCGGCGCCCCGGCACCGGGCATGGTC
GTCATCTCGTGCGAGCCGGACGGCGCATCCGCCCCCACCGATTCCGCCCTCACCGATTCC
GCCCTCACCGATTCCGCCCCGGCCGGCTCGGCCCCGGCCGACTCCACCGCCCTCGCCGAC
GCCACCCGGCAAGCCACCACCCGCGTCCTCGCCCTGCTCCAGGAATGGGTCGCCGACGAA
CGGCTCGCGGCCTGCCGCCTGGCCCTCCTCACGCACGGCTCGGTCACCGCGACCCCCGAC
GAGCCCGTGTCCGACCTCGCACACGCCGCCGTCTGGGGACTGGTCCGCTCCGTGCAGACC
GAGAACCCCGACCGGTTCCTGCTGGCCGACACCGACGACACCGACGCCTCCCGCAACGCC
CTTCCCCTGCTGGCCGGGGAACCGCAGATCGCCCTGCGAAATGGTGCCGTCCGCATCCCG
CGGATGACACGAGTGCCCGTCCGGCAGCCACAGCCGAGCACCACCGACGCCGACTGGGAC
CCGGAGGCCACGGTCCTCATCACGGGCGGTACCGGCGTCCTCGGCCGGCTCGTCGCCCGT
CATCTCGCCACGGCCCACGGGGTACGGCACCTGCTGCTGGCCACCCGCCGCGGCACGGCC
GCGGACGGCGCCGCCGACCTGGTCGCCGAACTCGCCGGCCTCGGCGCCGAGGCCACGGTC
GCGGCCTGCGACATCGGGGACCGGGCGGCCGTCGCCGCGCTCCTCGACCAAGTGCCCGCG
CAGCACCCCCTGAAAGCCGTGATCCACACGGCCGGTGTGGTCGACGACGGCATCCTCACC
TCGCTCACTCCGGAGCGCATGGAGGCCGTCCTGCACGCGAAGGCGTTCGGCGCCGCGCAC
CTGCACGACCTGACCCGCGACGCCGGCCTCACCACCTTCACCGTCTTCTCCTCGGCCGCC
GCCTCCTTCGGCAGTCCCGGACAGGGCAACTACACCGCGGCGAACGCCTTTCTGGACGCC
CTGATGCAGCACCGCCACACCCAGGCACTGCCGGGCCGGTCGCTCGCCTGGGGCCTTTGG
GGCGAGGCCGACGGCATGACCCGCAACCTCGCCGGCACCGACTTCGCGCGCATGGCCCGC
GGCGGCCTGCTCCCCCTGTCCAACGCACAGGGACTCGCGCTCCTCGACACAGCGGATCGC
CTCGGCCCTTTCGGTGACGGGCTGCTCCTCGCCACCCGGCTCGACGCGGCCACCCTCCAC
GCACAGGCCACGGCCGGCGCCCTGCCGCGCATCCTGCACGGGCTGATCCGCATCCCGGCC
CGGCGGTCCGCCGACCACGGCATCGCGACCGACACCCCCGCCACGCTGCGCGAGCGCCTG
GCCGGACTCACCATCCCCGCGCAGCGCACCGGTCTCCTCCTGGAACTCGTACGGACCCAT
GCCGCCGCCGTCCTCGGCCACCCCACCAGCGCCGTCACAGCCGCGGACGGCGCACTCCCG
GACGATCTGGTCCCGGCCGACACCGAGTTCCGCGACCTCGGCTTCGACTCGCTGACCGCC
GTCGAACTCCGCAACCGGATCAACGCCGTCACCGGCCTGCGCCTCCCGGCAACGCTCATC
TTCGACCAGCCCAGCCCCGCGGCACTCGCCGATCACCTCGCGACCCGCCTGACGGCCGAG
GCGGGCACGCCGGACGAGCCGGCCCCTGCCGCCGCGGCAGCCGGGGCCGGGAGCGCAGGG
AGTGCCGAGACCGGACAGCAGCGCAGTACGGGGAGCGAGAAGCAGCAGACCAGGGGCGGC
ACCTCCACCGAAACCGTCGAATCCCTGTTCTGGATCGGACACGACACCCGCCGCATCGAG
GAGTCCATGGCCCTGCTCTCGGCGGCCTCCTTCTTCCGGCCCGCCTTCACGGACCCCTCG
GACATCCCGGAGCCGACGTTCGTCCGGCTCGCCCAGGGTGAAGCGCGCGCCCAAGGTGAA
GCACTCGCCCGGGGCGAAACACGGCCCGCCCTCATCTGCCTGCCCACCGTCGCCGCCGTG
TCGAGCGTGTACCAGTACTCACGTTTCGCGGCGGGACTGAACGGACACCGAGACGTCTGG
TACGTTCCTGCGCCAGGGTTCCTGGAGGGCGAACCCCTGCCGTCCGGAATCGGCGCGGTG
ACCCGCATGTTCGCCGACGCGATCGTCCGGTTCACCGACGGCGCGCCTTTTGCGCTCGCC
GGGCATTCCGCGGGCGGATGGTTCGTCTACGCGGTGACGAGTCATCTGGAGCGTCTAGGC
GTCCGTCCGGAAGCGGTGGTGACCATGGACGCCTATCTCCCGGACGACGGCATCGCACCT
GTCGCGTCCGCGCTGACAAGTGAAATCTTCGACCGCGTCACGCAGTTTGTGGACGTGGAC
TACACACGCCTGGTCGCCATGGGCGGATACTTCCGCATCTTCTCCGGCTGGAGTCCTCCG
GACATCACCACACCCGCCCTCTTCCTGCGCGGCCGGGACGGAGAACAGATGCCGCCGCCG
TGGGGAGTTCCGCACACCGTTCTGGACATCCAGGGGAATCACTTCACGATGCTGGAACAG
TTTGCGGATTCGACTGCTCGGCATGTCGACGAATGGCTGACAGAAATCGCATCAGTGCGG
CGCTGA
[10] KS34..409
[10] AT578..899
[10] malonyl-CoA774..778
[10] kr1212..1392
[10] ACP1495..1565
[11] KS1590..1967
[11] AT2139..2457
[11] methylmalonyl-CoA not conserved YASHS(Y->W)2328..2332
[11] ACP2537..2607
[12] KS2635..3012
[12] AT3263..3599
[12] malonyl-CoA3459..3463
[12] DH3650..3827
[12] KR4183..4363
[12] ACP4473..4554
[12] TE4670..4873
[10] KS100..1227
[10] AT1732..2697
[10] malonyl-CoA2320..2334
[10] kr3634..4176
[10] ACP4483..4695
[11] KS4768..5901
[11] AT6415..7371
[11] methylmalonyl-CoA not conserved YASHS(Y->W)6982..6996
[11] ACP7609..7821
[12] KS7903..9036
[12] AT9787..10797
[12] malonyl-CoA10375..10389
[12] DH10948..11481
[12] KR12547..13089
[12] ACP13417..13662
[12] TE14008..14619

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [4670-4873]  2.5e-22 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [570-706]  G3DSA:3.40.366.10 [774-889]  G3DSA:3.40.366.10 [2131-2260]  G3DSA:3.40.366.10 [2328-2444]  G3DSA:3.40.366.10 [3255-3391]  G3DSA:3.40.366.10 [3459-3586]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1212-1379]  5.49999999999995e-55 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [2565-2580]  PS00012 [4512-4527]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1488-1607]  4.90001027782405e-26 SSF47336 [2530-2652]  7.19999557654549e-28 SSF47336 [4465-4571]  1.60000240695997e-20 SSF47336
SSF47336   ACP_like
 [1495-1565]  PS50075 [2537-2607]  PS50075 [4473-4554]  PS50075
PS50075   ACP_DOMAIN
 [1493-1569]  1.80000000000002e-63 G3DSA:1.10.1200.10 [2535-2611]  1.80000000000002e-63 G3DSA:1.10.1200.10 [4473-4557]  1.80000000000002e-63 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1498-1564]  3.7e-08 PF00550 [2540-2606]  4.80000000000001e-10 PF00550 [4499-4553]  5.59999999999999e-11 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [4183-4362]  3.29999999999997e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  1.10000000000001e-100 PF00109 [1590-1841]  2.09999999999996e-101 PF00109 [2635-2886]  5.30000000000001e-102 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-409]  2.8e-47 PF02801 [1849-1967]  3.2e-47 PF02801 [2894-3012]  3.09999999999998e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [578-899]  1.5e-63 PF00698 [2139-2457]  1.10000000000001e-102 PF00698 [3263-3599]  1.2e-62 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-26]  6.70000000000001e-12 PF08990
PF08990   Docking
 [4-34]  7.70000171387738e-07 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [574-894]  1.90000694315261e-68 SSF52151 [2135-2440]  2.59998233910302e-65 SSF52151 [3259-3569]  3.89999861795218e-68 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [708-773]  1e-17 SSF55048 [2262-2327]  7.79998304125571e-18 SSF55048 [3393-3458]  1.29999924468179e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-296]  G3DSA:3.40.47.10 [297-460]  G3DSA:3.40.47.10 [1593-1853]  G3DSA:3.40.47.10 [1854-2018]  G3DSA:3.40.47.10 [2638-2898]  G3DSA:3.40.47.10 [2899-3064]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-407]  3.30001976117415e-105 SSF53901 [1583-1965]  1.50000965748778e-105 SSF53901 [2628-3007]  4.20003460493095e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1211-1417]  1.99999999999999e-66 G3DSA:3.40.50.720 [4183-4370]  6.49999999999992e-71 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1754-1770]  PS00606 [2799-2815]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [578-880]  8.89993011983204e-125 SM00827 [2139-2437]  2.1000026783403e-115 SM00827 [3263-3580]  1.79999754022378e-116 SM00827
SM00827   PKS_AT
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [4672-4873]  1.09999184471405e-105 SM00824
SM00824   PKS_TE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1496-1568]  6.90001478563507e-31 SM00823 [2538-2610]  8.79996401030972e-33 SM00823 [4474-4557]  1.10000150671643e-35 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [3650-3827]  1.19999063421924e-84 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-462]  SM00825 [1593-2020]  SM00825 [2638-3064]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1212-1392]  1.60000240695997e-51 SM00822 [4183-4363]  1.20000117458134e-54 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit