close all open/close all

CDS information : Aver_00100


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction71,115 / 71,828 / + [in whole cluster]
160 / 873 / + [in contig]
Location71115..71828 [in whole cluster]
160..873 [in contig]
TypeCDS
Length714 bp (237 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)reductase
Gene
Gene (GenBank)orf-1
EC number
Keyword
Note
Note (GenBank)
  • contains NAD(P)H binding domain; not function in avermectin biosynthesis
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
Family/Domain
FD
IPR002198

close this sectionSequence

selected fasta
>putative oxidoreductase [reductase]
MCVDRDGRGAGVTADLARTRGARAAWPEVADVSDGAAMERFAERVAETYGVVDLLVNNAG
IGMAGRFLDTSVEDWQRTLGVNLWGVIHGCRLIGRQMAERGQGGHIVTVASAAAFQPTRA
VPAYATSKAAVLMLSECLRAEFAEFGVGVSVVCPGFVRTSFASAMHFAGVPRLEQERLRA
LFAGRGCSAEKVAAAVLRSVARDSAVVTVTAEARLSRLMSRFTPRLRAAVARMDPPS
selected fasta
>putative oxidoreductase [reductase]
GTGTGCGTGGACCGGGACGGCCGCGGCGCCGGGGTGACGGCCGACCTGGCCCGGACGCGG
GGCGCGCGGGCGGCCTGGCCCGAGGTGGCCGACGTGTCCGACGGAGCGGCGATGGAGCGG
TTCGCCGAGCGCGTCGCCGAGACGTACGGGGTCGTGGACCTGCTGGTGAACAACGCCGGC
ATCGGCATGGCGGGGCGTTTTCTCGACACGTCCGTCGAGGACTGGCAGCGCACCCTGGGC
GTCAACCTCTGGGGTGTCATTCATGGTTGCCGCCTCATCGGCCGGCAGATGGCGGAGCGC
GGGCAGGGCGGGCACATCGTGACGGTGGCGTCGGCGGCGGCGTTCCAGCCGACGCGGGCG
GTCCCCGCGTATGCCACCAGCAAGGCGGCGGTGCTGATGCTGAGCGAGTGCCTGCGCGCG
GAGTTCGCGGAGTTCGGGGTCGGAGTGAGCGTGGTGTGCCCGGGCTTCGTCCGTACGTCG
TTCGCGTCGGCGATGCATTTCGCCGGTGTGCCCCGGCTGGAGCAGGAGCGGCTGCGGGCG
CTGTTCGCCGGTCGCGGATGCAGCGCGGAGAAGGTGGCCGCGGCGGTACTGCGGTCGGTG
GCGCGCGACTCGGCCGTGGTGACCGTGACGGCGGAAGCGCGGCTGTCACGGCTGATGAGC
CGCTTCACGCCACGCCTGCGCGCCGCGGTGGCGCGGATGGATCCCCCTTCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [50-61]  3.0999994589937e-10 PR00080 [104-112]  3.0999994589937e-10 PR00080 [124-143]  3.0999994589937e-10 PR00080
PR00080   SDRFAMILY
 [10-142]  5.00000000000001e-22 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [50-61]  2.30000440726534e-17 PR00081 [98-114]  2.30000440726534e-17 PR00081 [124-143]  2.30000440726534e-17 PR00081 [145-162]  2.30000440726534e-17 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-208]  3.99999999999998e-51 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [111-139]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-24]  0.158 Signal
Bacteria, Gram-negative   
 [1-24]  0.114 Signal
Eukaryota   
TMHMM No significant hit