close all open/close all

CDS information : Aver_00110


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction71,886 / 73,124 / + [in whole cluster]
931 / 2,169 / + [in contig]
Location71886..73124 [in whole cluster]
931..2169 [in contig]
TypeCDS
Length1,239 bp (412 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)glycosyl transferase
Gene
Gene (GenBank)aveBI
EC number
Keyword
Note
Note (GenBank)
  • transfer of oleandrose onto polyketide-derived aglycons
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)
[17177349] The in vitro characterization of the iterative avermectin glycosyltransferase AveBI reveals reaction reversibility and sugar nucleotide flexibility. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>glycosyltransferase [glycosyl transferase]
MSDHFLFMSAPFWGHVFPSLAVAEELVHRGHHVTFVTGAEMADAVRSVGADFLRYESAFE
GVDMYRLMTEAEPNAIPMTLYDEGMSMLRSVEEHVGKDVPDLVAYDIATSLNVGRVLAAS
WSRPAMTVIPLFASNGRFSTMQSVLDPDSAQVSAPPPRFSEQMELFGLGALVPRLAELLV
SRGITEPVDDFLSGPEDFNLVCLPRAFQYAGDTFDERFAFVGPCLGKRRGLGEWTPPGSG
HPVVLISLGTVFNRQLSFFRTFVRAFTDVPVHVVISLGKGVDPDVLRPLPPNVEVHRWVP
HHAVLEHARALVTHGGTGSVMEALHAGCPVLVMPLSRDAQVTGRRIAELGLGRMVQPEEV
TATTLRRHVLDIISDDAITRQVRQMQRATVEAGGALRAADETERFLRRTRRH
selected fasta
>glycosyltransferase [glycosyl transferase]
ATGTCAGATCATTTTCTCTTCATGAGTGCGCCGTTCTGGGGGCATGTGTTCCCCAGTCTC
GCCGTGGCGGAGGAGCTCGTGCACCGGGGCCACCACGTCACCTTTGTGACGGGCGCGGAA
ATGGCCGATGCGGTGCGTTCCGTGGGCGCTGATTTCCTGCGGTACGAGTCCGCCTTCGAG
GGTGTCGACATGTACCGGCTGATGACCGAGGCCGAGCCGAACGCCATCCCCATGACGCTG
TACGACGAGGGCATGTCCATGTTGCGTTCGGTGGAGGAGCACGTCGGCAAGGACGTTCCG
GACCTGGTGGCCTACGACATCGCCACCTCCCTCAACGTGGGTCGTGTCCTCGCCGCCTCC
TGGAGCAGGCCGGCCATGACGGTCATTCCCCTGTTCGCGTCCAACGGGCGCTTCTCCACG
ATGCAGTCGGTATTGGATCCGGATTCCGCTCAGGTCAGTGCGCCGCCGCCGCGCTTCTCG
GAGCAGATGGAGTTGTTCGGCCTCGGGGCGCTGGTGCCGCGCCTCGCGGAGCTGCTCGTT
TCCCGGGGTATCACGGAACCGGTCGACGATTTCCTTTCCGGACCGGAGGACTTCAACCTG
GTGTGTCTGCCGCGCGCCTTCCAGTACGCGGGCGACACCTTCGACGAGCGGTTCGCCTTC
GTCGGACCATGTCTGGGTAAGCGCAGGGGTCTGGGCGAGTGGACACCACCGGGCAGCGGG
CATCCAGTGGTGCTCATCTCCCTCGGGACCGTGTTCAACCGGCAGCTGTCCTTCTTCCGC
ACGTTCGTCCGGGCGTTCACCGACGTCCCCGTGCACGTCGTGATCTCGCTCGGCAAGGGG
GTCGACCCCGATGTGCTGCGGCCGCTGCCGCCGAATGTCGAGGTGCACCGGTGGGTGCCG
CACCATGCGGTGCTGGAGCATGCCAGGGCTCTGGTCACGCACGGCGGTACCGGCAGTGTG
ATGGAGGCACTGCACGCAGGGTGCCCGGTGCTCGTCATGCCCTTGTCGCGGGACGCGCAG
GTGACCGGCCGGCGGATCGCCGAGCTGGGGCTGGGTCGTATGGTGCAGCCGGAGGAGGTC
ACGGCGACGACGCTGCGCCGGCACGTGCTGGACATCATCTCCGATGACGCGATCACCCGA
CAGGTCAGGCAGATGCAGCGGGCCACGGTCGAGGCGGGCGGCGCCCTGCGGGCAGCGGAC
GAGACCGAGCGGTTTCTGCGCCGGACGCGCCGTCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [240-378]  4.9e-16 PF00201
PF00201   UDPGT
IPR004276 Glycosyl transferase, family 28 (Domain)
 [6-103]  1.6e-09 PF03033
PF03033   Glyco_transf_28
IPR006326 UDP-glycosyltransferase, MGT (Family)
 [8-408]  TIGR01426
TIGR01426   MGT
SignalP
 [1-23]  0.893 Signal
Bacteria, Gram-negative   
 [1-23]  0.806 Signal
Eukaryota   
 [1-23]  0.239 Signal
Bacteria, Gram-positive   
TMHMM No significant hit