close all open/close all

CDS information : Aver_00120


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction74,109 / 73,030 / - [in whole cluster]
3,154 / 2,075 / - [in contig]
Locationcomplement(73030..74109) [in whole cluster]
complement(2075..3154) [in contig]
TypeCDS
Length1,080 bp (359 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)dTDP-glucose 4,6-dehydratase
Gene
Gene (GenBank)aveBII
EC number4.2.1.46
Keyword
  • L-oleandrose
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • function in oleandrose biosynthesis
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)
Related Reference
ACC
Q54116
PmId
[7883182] Cloning of the genes encoding thymidine diphosphoglucose 4,6-dehydratase and thymidine diphospho-4-keto-6-deoxyglucose 3,5-epimerase from the erythromycin-producing Saccharopolyspora erythraea. (Gene. , 1995)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [dTDP-glucose 4,6-dehydratase]
MRLLVTGGAGFIGSHFVRRLLTGAYPAFTGAEVVVLDKLTYAGRLENLAPVLGSPSLIFV
HGDICDGPLVADLMDGSDMVVHFAAESHVDRSVADAAEFVRTNVLGTHTLLRAATDAAVD
RFVYISTDEVYGSIDSGSWTEDAPLEPNSPYSASKASSDLLARSFHRTHGLPVIITRCSN
NYGPHQFPEKLIPRFVTHLLNGTKVPLYGDGENVRDWLHVDDHCRGIALVAERGRPGEIY
HIGGGTELSNRELTARLLDLLGVDWSMVEPVTDRKGHDRRYSLDISKISAELGYAPRVPF
EEGLAQTVQWYVENRTLWEPLTARPELPVSDGASGAETARSRPLPAGRRPPRPWPAASA
selected fasta
>putative dTDP-glucose 4,6-dehydratase [dTDP-glucose 4,6-dehydratase]
ATGCGCCTACTCGTGACGGGCGGCGCCGGTTTCATCGGTTCCCATTTCGTACGGCGGTTG
CTGACGGGCGCGTATCCGGCGTTCACCGGTGCCGAGGTCGTGGTGCTCGACAAGCTGACC
TACGCGGGTCGCCTGGAGAACCTCGCACCGGTCCTGGGAAGCCCATCCCTGATCTTCGTG
CACGGCGACATCTGCGACGGGCCCTTGGTCGCGGACCTGATGGACGGCTCCGACATGGTG
GTCCACTTCGCGGCGGAGTCACACGTGGACCGGTCCGTGGCCGACGCCGCCGAGTTCGTA
CGCACCAATGTCCTCGGCACTCACACCCTGCTCCGCGCCGCCACCGACGCCGCCGTGGAC
CGCTTCGTGTACATCTCGACGGACGAGGTCTACGGCTCCATCGACTCCGGCTCGTGGACC
GAGGACGCCCCGCTGGAGCCGAACTCGCCCTACTCCGCGTCCAAGGCGTCCTCCGACCTG
CTCGCCCGGTCCTTCCACCGCACGCACGGCCTACCAGTGATCATCACCCGATGCTCGAAC
AACTACGGCCCCCACCAGTTCCCGGAGAAACTCATCCCGCGGTTCGTCACCCATCTGCTG
AACGGCACGAAGGTGCCCTTGTACGGCGACGGCGAAAACGTCCGCGACTGGCTGCACGTG
GACGACCACTGCCGTGGCATCGCCCTGGTCGCCGAACGCGGCAGGCCCGGCGAGATCTAC
CACATCGGAGGCGGGACGGAGCTGTCCAACCGTGAGCTCACCGCCCGGCTCCTGGACCTG
CTCGGCGTGGACTGGTCGATGGTCGAACCCGTGACCGACCGCAAGGGGCACGACCGGCGC
TACTCGCTGGACATCAGCAAGATCTCCGCCGAGCTCGGTTACGCGCCCCGCGTGCCCTTC
GAGGAGGGGCTGGCACAGACCGTTCAGTGGTACGTGGAGAACCGAACCCTGTGGGAGCCA
CTCACCGCCCGGCCCGAGCTGCCGGTCAGTGACGGCGCGTCCGGCGCAGAAACCGCTCGG
TCTCGTCCGCTGCCCGCAGGGCGCCGCCCGCCTCGACCGTGGCCCGCTGCATCTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [4-243]  4.9e-69 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-321]  4.1e-130 TIGR01181
TIGR01181   dTDP_gluc_dehyt: dTDP-glucose 4,6-dehydratase
IPR016040 NAD(P)-binding domain (Domain)
 [1-190]  2.3e-66 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM No significant hit