close all open/close all

CDS information : Aver_00130


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction74,993 / 74,094 / - [in whole cluster]
4,038 / 3,139 / - [in contig]
Locationcomplement(74094..74993) [in whole cluster]
complement(3139..4038) [in contig]
TypeCDS
Length900 bp (299 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)glucose-1-phosphate thymidyltransferase
Gene
Gene (GenBank)aveBIII
EC number2.7.7.24
Keyword
  • L-oleandrose
Note
Note (GenBank)
  • function in oleandrose biosynthesis
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)
Related Reference
ACC
Q9AGY4
PmId
[12147463] Homologs of the Rml enzymes from Salmonella enterica are responsible for dTDP-beta-L-rhamnose biosynthesis in the gram-positive thermophile Aneurinibacillus thermoaerophilus DSM 10155. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [glucose-1-phosphate thymidyltransferase]
MKGIVLAGGTGSRLYPLTRALSKQLLPVYDKPMIYYPLSVLMLGGIKDILVISSPDHLEQ
FRRLLGDGSRLGLNIDYAAQQRPGGIAEAFLIGADFIGQDQVSLVLGDNIFHGMGFSHLL
RSHTRDVDGCVLFGYAVTDPERYGVGEVDASGKLLSVEEKPTAPRSNLAITGLYLYDNDV
IEVARGIRSSARGELEITDVNRAYLAEGRARLVDLGRGFTWLDAGTHDSLMHAGQYVQVL
EKRQGVRIACLEEIAFRMGLIDADDCYLRGVELAGSGYGEYLMSIAAEAAVRSPGCAYS
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [glucose-1-phosphate thymidyltransferase]
ATGAAGGGAATCGTGCTCGCGGGGGGAACCGGCTCTCGGCTTTACCCGTTGACCCGTGCC
CTTTCCAAGCAGCTGCTCCCTGTCTACGACAAACCCATGATCTACTACCCGCTCTCCGTG
TTGATGCTCGGCGGCATAAAAGACATCCTGGTGATTTCCTCACCCGATCATCTCGAACAA
TTCCGGAGACTGCTCGGAGACGGAAGCCGCCTCGGGCTGAACATCGACTACGCCGCGCAG
CAGCGACCGGGAGGAATCGCCGAGGCATTCCTCATCGGCGCCGATTTCATCGGTCAGGAT
CAGGTGTCCCTTGTCCTTGGGGACAACATCTTCCATGGCATGGGCTTTTCGCACCTGCTG
CGCAGCCACACCCGCGATGTCGACGGCTGTGTGTTGTTCGGATACGCGGTGACGGATCCC
GAACGGTACGGAGTCGGAGAGGTCGACGCCTCCGGAAAGCTGCTGTCCGTCGAGGAGAAA
CCCACCGCCCCCCGGTCCAACCTGGCGATCACAGGCCTGTACCTGTACGACAACGACGTG
ATCGAGGTGGCCCGGGGCATCCGCTCGTCGGCCCGCGGCGAGCTGGAGATCACCGACGTC
AACAGGGCCTACCTCGCCGAGGGGCGGGCCCGGCTGGTGGACCTGGGCCGGGGCTTCACC
TGGCTCGATGCGGGGACGCACGACTCGCTGATGCACGCCGGGCAGTATGTGCAGGTCCTG
GAGAAGCGCCAGGGAGTACGGATCGCCTGTCTCGAGGAGATCGCCTTCCGGATGGGTCTG
ATCGACGCGGACGACTGCTATCTGCGCGGGGTCGAACTGGCCGGCTCCGGCTACGGCGAG
TATCTGATGAGTATTGCGGCGGAAGCCGCGGTGAGGAGCCCGGGATGCGCCTACTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-236]  1.9e-61 PF00483
PF00483   NTP_transferase
IPR005907 Glucose-1-phosphate thymidylyltransferase, short form (Family)
 [2-286]  7.20000000000003e-127 TIGR01207
TIGR01207   RmlA
SignalP
 [1-20]  0.252 Signal
Eukaryota   
TMHMM No significant hit