close all open/close all

CDS information : Aver_00140


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction75,119 / 76,150 / + [in whole cluster]
4,164 / 5,195 / + [in contig]
Location75119..76150 [in whole cluster]
4164..5195 [in contig]
TypeCDS
Length1,032 bp (343 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)dTDP-4-keto-6-deoxy-L-hexose 4-reductase
Gene
Gene (GenBank)aveBIV
EC number
Keyword
  • L-oleandrose
Note
Note (GenBank)
  • function in oleandrose biosynthesis
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)
Related Reference
ACC
Q2PC38
NITE
Rubra_00520
PmId
[16614891] Functional characterization of ketoreductase (rubN6) and aminotransferase (rubN4) genes in the gene cluster of Streptomyces achromogenes var. rubradiris. (Biotechnol Lett. , 2006)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [dTDP-4-keto-6-deoxy-L-hexose 4-reductase]
MGRFSVCPPRPTGILKSMLTTGMCDRPLVVVLGASGYIGSAVAAELARWPVLLRLVARRP
GVVPPGGAAETETRTADLTAASEVALAVTDADVVIHLVARLTQGAAWRAAESDPVAERVN
VGVMHDVVAALRSGRRAGPPPVVVFAGSVYQVGRPGRVDGSEPDEPVTAYARQKLDAERT
LKSATVEGVLRGISLRLPTVYGAGPGPQGNGVVQAMVLRALADEALTVWNGSVVERDLVH
VEDVAQAFVSCLAHADALAGRHWLLGSGRPVTVPHLFGAIAAGVSARTGRPAVPVTAVDP
PAMATAADFHGTVVDSSAFRAVTGWRPRLSLQEGLDHMVAAYV
selected fasta
>putative NDP-hexose C-4 ketoreductase [dTDP-4-keto-6-deoxy-L-hexose 4-reductase]
ATGGGGCGGTTTTCGGTGTGCCCGCCCCGGCCGACCGGAATACTGAAGAGCATGCTGACG
ACTGGGATGTGCGACCGACCGCTGGTCGTCGTACTCGGAGCCTCCGGCTATATCGGGTCG
GCCGTCGCGGCGGAACTCGCCCGGTGGCCGGTCCTGTTGCGGCTGGTGGCCCGGCGACCG
GGCGTCGTTCCGCCGGGCGGCGCCGCGGAGACCGAGACGCGTACGGCCGACCTGACGGCG
GCGAGCGAGGTCGCCCTCGCCGTGACGGACGCCGACGTGGTGATCCACCTGGTCGCGCGC
CTCACCCAGGGAGCGGCATGGCGGGCGGCGGAGAGCGATCCGGTGGCCGAGCGGGTGAAC
GTCGGGGTGATGCACGACGTCGTCGCGGCCCTGCGGTCCGGGCGCCGCGCCGGGCCGCCC
CCGGTGGTGGTGTTCGCCGGGTCGGTCTACCAGGTGGGCCGCCCGGGTCGGGTCGACGGC
AGTGAGCCGGACGAGCCCGTGACGGCCTATGCCCGTCAGAAACTCGACGCCGAACGGACG
TTGAAGTCCGCCACGGTCGAGGGTGTCCTGCGGGGGATCTCGCTGCGGCTGCCCACCGTC
TACGGCGCGGGGCCGGGCCCGCAGGGCAACGGCGTCGTGCAGGCGATGGTGCTCCGGGCG
CTCGCCGACGAGGCCCTCACCGTGTGGAACGGAAGCGTGGTGGAGCGTGACCTGGTGCAT
GTGGAGGATGTCGCGCAGGCCTTCGTGAGCTGCCTGGCGCACGCGGATGCGCTCGCCGGG
CGGCACTGGCTGCTCGGCAGCGGTCGTCCTGTGACCGTCCCGCACCTCTTCGGTGCCATC
GCCGCCGGCGTGTCCGCCCGCACCGGGCGCCCCGCGGTGCCCGTGACCGCGGTGGACCCT
CCGGCGATGGCGACGGCGGCGGACTTCCACGGGACCGTCGTCGACTCCTCGGCGTTCCGC
GCGGTCACCGGGTGGCGGCCGCGGCTGTCGCTTCAGGAGGGCCTGGACCACATGGTGGCG
GCTTACGTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [29-266]  8.20000000000006e-36 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [29-247]  8.40000000000001e-32 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-43]  0.523 Signal
Bacteria, Gram-negative   
 [1-1]  Signal-anchor
Eukaryota   
TMHMM No significant hit