close all open/close all

CDS information : Aver_00150


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameAvermectin
Contig
Start / Stop / Direction76,881 / 76,204 / - [in whole cluster]
5,926 / 5,249 / - [in contig]
Locationcomplement(76204..76881) [in whole cluster]
complement(5249..5926) [in contig]
TypeCDS
Length678 bp (225 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose 5-epimerase
Product (GenBank)dTDP-4-keto-6-deoxyhexose 3,5-epimerase
Gene
Gene (GenBank)aveBV
EC number5.1.3.-
Keyword
  • L-oleandrose
Note
Note (GenBank)
  • function in oleandrose biosynthesis
Reference
ACC
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>NDP-hexose 5-epimerase [dTDP-4-keto-6-deoxyhexose 3,5-epimerase]
MTLGRPRRSSADRPAPPAGARATAAGVTVRRLVVEGAVEFTPTVFPDERGLFVTPYQEPV
LSEAVGHRFPTAQTCQSVSRRGVVRGVHFTATPPGQAKYVHCARGRALDFVVDLRTGSPT
FGQWDSVLLDQERFRSVYLPIGVGHAFVALEDDTAMVYLMSSGYVPQNEHALSPEDPDLA
LPLGHHLGRAPILSERDRRAPTLQQALRRGMLPEYRASRGLDEKL
selected fasta
>NDP-hexose 5-epimerase [dTDP-4-keto-6-deoxyhexose 3,5-epimerase]
ATGACCCTTGGCCGGCCTCGCCGGAGCTCCGCCGACCGGCCCGCCCCGCCCGCGGGCGCC
CGGGCCACCGCCGCCGGTGTCACGGTCCGGAGGCTCGTCGTCGAGGGCGCCGTCGAATTC
ACCCCGACGGTCTTCCCCGACGAGCGCGGGCTCTTCGTCACCCCCTACCAGGAACCGGTC
CTCAGCGAGGCCGTCGGGCACCGGTTTCCCACCGCGCAGACCTGCCAGAGCGTCTCGCGC
CGCGGCGTCGTCCGCGGCGTGCACTTCACCGCGACACCACCCGGCCAGGCCAAGTACGTC
CACTGCGCCCGGGGACGGGCCCTGGACTTCGTCGTCGACCTGCGCACCGGCTCACCGACT
TTCGGGCAGTGGGACTCGGTCCTCCTCGACCAGGAGCGCTTCCGTTCCGTCTACCTGCCG
ATCGGGGTCGGGCACGCGTTCGTGGCGCTGGAAGACGACACGGCGATGGTGTACCTGATG
TCGAGCGGCTACGTTCCGCAGAACGAACACGCCCTCTCGCCCGAGGATCCGGACCTCGCC
CTGCCCCTCGGCCACCACCTCGGGCGGGCACCGATCCTCTCCGAGCGCGACCGGCGCGCG
CCGACTCTCCAGCAGGCCCTGCGACGCGGCATGTTGCCGGAGTACCGCGCGAGCCGCGGC
CTCGACGAGAAGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [30-205]  2.89999999999999e-56 PF00908
PF00908   dTDP_sugar_isom
 [32-210]  PD001462
PD001462   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [27-210]  1.40000506907309e-64 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [28-216]  3.89999999999997e-59 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP
 [1-11]  0.499 Signal
Bacteria, Gram-negative   
 [1-22]  0.424 Signal
Bacteria, Gram-positive   
TMHMM No significant hit